Buuey is using an unsupported spec.
Druid restoration healing for player Buuey is not currently supported.
close

SimulationCraft 710-01

for World of Warcraft 7.1.0 Live (wow build level 22882, git build 375fc9d)

Current simulator hotfixes

Horrific Appendages

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-09 In-game testing shows that the actual rppm is much closer to 1.3~ than 0.7, so we slightly underestimated down to 1.25.
Horrific Appendages rppm 1.25 0.70

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-10 Instincts of the mongoose effect increased from 10% to 20%
(effect#1) base_value 0.00 0.00 Verification Failure (10.00)

Mark of the Hidden Satyr

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-10 In-game testing shows that the damage from this ability is roughly 10% higher than what spelldata shows.
Mark of the Hidden Satyr (effect#1) average 29.13 26.49

Table of Contents

Raid Summary

 

Raid Event List
0 adds,count=5,first=20,cooldown=30,duration=20,last=300
1 movement,first=20,cooldown=30,distance=25,last=300
2 movement,players_only=1,first=12,cooldown=16,distance=8

Actions per Minute / DPS Variance Summary

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Int Crit Haste Mastery Vers wowhead
Mortwraith - 19.15 - 10.92 9.50 8.50 12.96 wowhead
Táunks - 17.43 - 10.91 8.20 7.80 12.08 wowhead
Illistan - -0.29 - -0.45 -0.79 -0.51 -0.83 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Oinkie - 9.03 - 6.11 7.18 3.95 6.49 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Rothlandra - 11.79 - 10.57 11.40 14.47 10.62 wowhead
Sarkul - 13.15 - 11.21 11.54 12.65 11.61 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Mellarene - - 10.13 6.90 8.08 5.39 9.03 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Zipi 11.81 - - 10.63 13.11 5.98 10.19 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Faelik - - 13.01 13.29 14.72 12.84 10.78 wowhead
Raji - - 10.78 9.25 9.53 8.16 8.69 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Vait - 13.72 - 7.67 7.59 5.03 9.20 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Bowflexn - 15.80 - 10.97 13.06 16.72 11.91 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Alacastria -0.08 - - -0.14 -0.27 -0.14 -0.14 wowhead
Mortwraith

Mortwraith : 564037 dps, 235136 dps to main target

  • Race: Blood Elf
  • Class: Demonhunter
  • Spec: Havoc
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
564037.4 564037.4 934.9 / 0.166% 173456.7 / 30.8% 43004.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.0 13.0 Fury 2.01% 62.0 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Mortwraith/advanced
Talents
  • 15: Fel Mastery (Havoc Demon Hunter)
  • 30: Prepared (Havoc Demon Hunter)
  • 45: Bloodlet (Havoc Demon Hunter)
  • 60: Soul Rending (Havoc Demon Hunter)
  • 75: Momentum (Havoc Demon Hunter)
  • 90: Master of the Glaive (Havoc Demon Hunter)
  • 100: Fel Barrage (Havoc Demon Hunter)
  • Talent Calculator
Artifact
Professions
  • alchemy: 4
  • herbalism: 82
Scale Factors for Mortwraith Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 19.15 12.96 10.92 9.50 8.50
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 1.18 1.18 1.17 1.17 1.17
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste ~= Mastery
Pawn string ( Pawn: v1: "Mortwraith": Agility=19.15, CritRating=10.92, HasteRating=9.50, MasteryRating=8.50, Versatility=12.96 )

Scale Factors for other metrics

Scale Factors for Mortwraith Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 19.15 12.96 10.92 9.50 8.50
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 1.18 1.18 1.17 1.17 1.17
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste ~= Mastery
Pawn string ( Pawn: v1: "Mortwraith": Agility=19.15, CritRating=10.92, HasteRating=9.50, MasteryRating=8.50, Versatility=12.96 )
Scale Factors for Mortwraith Priority Target Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 7.25 5.44 5.36 4.13 3.17
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.17 0.17 0.17 0.17 0.17
Gear Ranking
Optimizers
Ranking
  • Agi > Vers ~= Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Mortwraith": Agility=7.25, CritRating=5.36, HasteRating=4.13, MasteryRating=3.17, Versatility=5.44 )
Scale Factors for Mortwraith Damage Per Second (Effective)
Agi Vers Crit Haste Mastery
Scale Factors 19.15 12.96 10.92 9.50 8.50
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Mortwraith": Agility=19.15, CritRating=10.92, HasteRating=9.50, MasteryRating=8.50, Versatility=12.96 )
Scale Factors for Mortwraith Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for MortwraithTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Mortwraith 564037
Annihilation 17051 3.0% 17.3 16.90sec 388355 401188 Direct 34.7 133372 290953 194186 38.6% 0.0%  

Stats details: annihilation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.35 34.69 0.00 0.00 0.9680 0.0000 6737152.41 6737152.41 0.00 401188.14 401188.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.30 61.41% 133371.89 101136 159144 133389.35 118936 142807 2841463 2841463 0.00
crit 13.39 38.59% 290953.10 220476 346933 290875.34 0 312434 3895689 3895689 0.00
 
 

Action details: annihilation

Static Values
  • id:201427
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
Spelldata
  • id:201427
  • name:Annihilation
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$227518sw1+$201428sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
auto_attack_mh 8099 1.4% 131.3 3.05sec 24719 12136 Direct 131.3 20658 41317 24720 38.6% 18.9%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.30 131.30 0.00 0.00 2.0368 0.0000 3245563.30 4771285.47 31.98 12136.39 12136.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.77 42.47% 20658.40 18196 22939 20659.58 19732 21613 1152020 1693578 31.98
crit 50.67 38.59% 41317.03 36393 45877 41318.80 39434 43172 2093544 3077707 31.98
miss 24.86 18.94% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 4049 0.7% 131.3 3.05sec 12357 6067 Direct 131.3 10329 20660 12357 38.6% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.30 131.30 0.00 0.00 2.0368 0.0000 1622491.24 2385215.82 31.98 6067.11 6067.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.66 42.39% 10329.12 9098 11469 10329.41 9881 10764 574894 845149 31.98
crit 50.71 38.62% 20660.11 18196 22939 20660.66 19656 21539 1047597 1540066 31.98
miss 24.93 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blade Dance 47187 8.3% 18.3 15.64sec 1017804 753526 Direct 418.9 32075 64191 44476 38.6% 0.0%  

Stats details: blade_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.31 418.90 0.00 0.00 1.3508 0.0000 18630938.96 27389245.04 31.98 753526.35 753526.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 257.15 61.39% 32074.90 16936 73378 32078.20 28774 36556 8248213 12125655 31.98
crit 161.75 38.61% 64191.34 33873 146756 64197.16 54460 75901 10382725 15263590 31.98
 
 

Action details: blade_dance

Static Values
  • id:188499
  • school:physical
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_dance
Spelldata
  • id:188499
  • name:Blade Dance
  • school:physical
  • tooltip:Dodge chance increased by {$s2=100}%.
  • description:Strike all nearby enemies for ${$sw2+2*$199552sw2+$200685sw2} Physical damage, and increase your chance to dodge by {$s2=100}% for {$d=1 second}.
 
Chaos Strike 56516 10.2% 77.3 4.76sec 295287 215667 Direct 154.5 101553 221399 147740 38.5% 0.0%  

Stats details: chaos_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.30 154.50 0.00 0.00 1.3692 0.0000 22826447.35 22826447.35 0.00 215667.34 215667.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 94.96 61.46% 101553.24 77797 122590 101529.19 97721 105375 9643574 9643574 0.00
crit 59.54 38.54% 221399.10 169597 267245 221372.10 204836 234970 13182873 13182873 0.00
 
 

Action details: chaos_strike

Static Values
  • id:162794
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
Spelldata
  • id:162794
  • name:Chaos Strike
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$222031sw1+$199547sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
Death Sweep 21215 3.7% 5.4 56.77sec 1556790 1539151 Direct 124.8 48467 96887 67120 38.5% 0.0%  

Stats details: death_sweep

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.38 124.79 0.00 0.00 1.0115 0.0000 8376058.67 12313599.65 31.98 1539150.80 1539150.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.72 61.48% 48466.91 25228 109302 48445.21 38230 57787 3718449 5466472 31.98
crit 48.07 38.52% 96886.54 50456 218605 96857.93 72215 127739 4657610 6847128 31.98
 
 

Action details: death_sweep

Static Values
  • id:210152
  • school:physical
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_dance
Spelldata
  • id:210152
  • name:Death Sweep
  • school:physical
  • tooltip:Dodge chance increased by {$s3=0}%.
  • description:Strike all nearby enemies for ${3*$210153sw2+$210155sw2} Physical damage, and increase your Dodge chance by {$s2=100}% for {$d=1 second}.
 
Demon's Bite 16258 2.9% 88.9 4.45sec 73127 57031 Direct 88.9 52766 105530 73126 38.6% 0.0%  

Stats details: demons_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.94 88.94 0.00 0.00 1.2822 0.0000 6503875.43 9561312.95 31.98 57030.53 57030.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.62 61.41% 52766.22 47205 59507 52787.11 50403 55320 2882046 4236880 31.98
crit 34.32 38.59% 105529.94 94410 119015 105569.43 98145 112707 3621830 5324433 31.98
 
 

Action details: demons_bite

Static Values
  • id:162243
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
Spelldata
  • id:162243
  • name:Demon's Bite
  • school:physical
  • tooltip:
  • description:Quickly attack for $sw2 Physical damage. |cFFFFFFFFGenerates $m3 to $M3 Fury.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.60
 
Eye Beam 69610 (98957) 12.3% (17.5%) 11.8 32.88sec 3311053 1693765 Periodic 559.2 0 49257 49257 100.0% 0.0% 4.9%

Stats details: eye_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.83 0.00 111.52 559.17 1.9549 0.1750 27543433.69 27543433.69 0.00 1693764.86 1693764.86
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 559.2 100.00% 49257.40 43566 54919 49265.55 45128 52554 27543434 27543434 0.00
 
 

Action details: eye_beam

Static Values
  • id:198013
  • school:chaos
  • resource:fury
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
Spelldata
  • id:198013
  • name:Eye Beam
  • school:chromatic
  • tooltip:
  • description:Blasts all enemies directly in front of you for $<dmg> Chaos damage. Eye Beam always critically strikes.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Anguish 29347 5.2% 0.0 0.00sec 0 0 Direct 57.9 144528 289446 200468 38.6% 0.0%  

Stats details: anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 57.93 0.00 0.00 0.0000 0.0000 11613022.30 11613022.30 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.57 61.40% 144528.03 13424 169230 144215.34 81742 163883 5140618 5140618 0.00
crit 22.36 38.60% 289446.21 26849 338461 288849.37 154702 329420 6472404 6472404 0.00
 
 

Action details: anguish

Static Values
  • id:202446
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202446
  • name:Anguish
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals {$202446s1=10} Chaos damage to the victim per application.}
 
Fel Barrage 49482 8.7% 10.1 41.31sec 1937058 1256764 Direct 158.9 88713 177408 122930 38.6% 0.0%  

Stats details: fel_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.08 158.90 49.21 0.00 1.5414 0.1988 19533886.66 19533886.66 0.00 1256764.25 1256764.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.60 61.42% 88713.23 67122 105769 88776.17 0 105769 8658407 8658407 0.00
crit 61.30 38.58% 177407.77 134245 211538 177537.49 0 211538 10875479 10875479 0.00
 
 

Action details: fel_barrage

Static Values
  • id:211053
  • school:chaos
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Spelldata
  • id:211053
  • name:Fel Barrage
  • school:magic
  • tooltip:Unleashing Fel.
  • description:At your command, unleash Fel, inflicting ${{$211052s1=0}} Chaos damage to your target and nearby enemies for each charge. Max 5 charges. Your damaging abilities have a chance to generate a charge.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Fel Rush 54997 9.7% 34.4 11.84sec 633758 1568826 Direct 119.1 131953 263931 183009 38.7% 0.0%  

Stats details: fel_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.41 119.15 0.00 0.00 0.4040 0.0000 21805115.12 21805115.12 0.00 1568826.18 1568826.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.06 61.32% 131953.48 128271 161700 131929.22 128697 137436 9640108 9640108 0.00
crit 46.09 38.68% 263930.97 256542 323399 263872.07 257082 278231 12165007 12165007 0.00
 
 

Action details: fel_rush

Static Values
  • id:195072
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.2500
  • min_gcd:0.2500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time=0
Spelldata
  • id:195072
  • name:Fel Rush
  • school:physical
  • tooltip:
  • description:Rush forward, incinerating anything in your path for {$192611s1=0} Chaos damage.$?a192939[ |cFFFFFFFFGenerates {$192939s1=25} Fury if you damage an enemy.|r][]
 
Fury of the Illidari 46875 (74977) 8.3% (13.3%) 7.1 60.48sec 4196726 3280823 Periodic 448.1 29880 59758 41423 38.6% 0.0% 5.3%

Stats details: fury_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.07 0.00 49.36 448.13 1.2793 0.4283 18562530.10 18562530.10 0.00 983355.79 3280822.63
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 275.0 61.37% 29880.43 18090 43415 29880.61 26867 32978 8217213 8217213 0.00
crit 173.1 38.63% 59757.65 36179 86830 59756.14 52809 67784 10345317 10345317 0.00
 
 

Action details: fury_of_the_illidari

Static Values
  • id:201467
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:3.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
Spelldata
  • id:201467
  • name:Fury of the Illidari
  • school:physical
  • tooltip:
  • description:Throws the |cFFFFCC99Twinblades of the Deceiver|r in a whirlwind of energy, causing ${7*($201628sw1+$201789sw1)} Chaos damage over {$d=3 seconds} to all nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Rage of the Illidari 28103 5.0% 7.0 60.48sec 1583375 0 Direct 31.9 349223 0 349223 0.0% 0.0%  

Stats details: rage_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.03 31.87 0.00 0.00 0.0000 0.0000 11128914.71 11128914.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.87 100.00% 349222.83 227929 2188122 349720.35 310352 704904 11128915 11128915 0.00
 
 

Action details: rage_of_the_illidari

Static Values
  • id:217070
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:217070
  • name:Rage of the Illidari
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201472=When Fury of the Illidari ends, {$s1=60}% of the damage it dealt erupts in an explosion of fel energy, dividing that Chaos damage among all neaby enemies.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:299564.26
  • base_dd_max:299564.26
 
Metamorphosis (_impact) 1854 0.3% 2.0 241.60sec 364291 0 Direct 7.0 75696 151424 104881 38.5% 0.0%  

Stats details: metamorphosis_impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 6.98 0.00 0.00 0.0000 0.0000 732480.66 732480.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.29 61.46% 75695.72 67122 84615 75540.25 0 84615 324924 324924 0.00
crit 2.69 38.54% 151423.97 134245 169230 146197.62 0 169230 407557 407557 0.00
 
 

Action details: metamorphosis_impact

Static Values
  • id:200166
  • school:chaos
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:200166
  • name:Metamorphosis
  • school:chromatic
  • tooltip:Stunned.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
 
Potion of the Old War 12626 2.2% 24.8 11.64sec 200733 0 Direct 24.8 144650 289476 200735 38.7% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.84 24.84 0.00 0.00 0.0000 0.0000 4985286.83 7328843.86 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.22 61.27% 144650.07 123216 155327 144655.04 133809 154497 2201256 3236055 31.98
crit 9.62 38.73% 289476.08 246432 310654 289455.08 254211 310654 2784030 4092788 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Throw Glaive 42798 (95374) 7.6% (16.9%) 47.8 8.41sec 792654 619420 Direct 108.5 113042 226056 156662 38.6% 0.0%  

Stats details: throw_glaive

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.83 108.51 0.00 0.00 1.2797 0.0000 16999535.75 24990927.79 31.98 619419.64 619419.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.63 61.40% 113042.11 96517 121670 113038.90 106312 117234 7531757 11072396 31.98
crit 41.88 38.60% 226056.50 193034 243341 226043.47 211137 235541 9467779 13918532 31.98
 
 

Action details: throw_glaive

Static Values
  • id:185123
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
Spelldata
  • id:185123
  • name:Throw Glaive
  • school:physical
  • tooltip:
  • description:Throw a demonic glaive at the target, dealing $sw1 Physical damage. The glaive can ricochet to ${$x1-1} additional enemies within 10 yards.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.90
 
    Bloodlet 52576 9.3% 0.0 0.00sec 0 0 Periodic 352.1 59392 0 59392 0.0% 0.0% 175.8%

Stats details: bloodlet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 352.08 352.08 0.0000 2.0000 20910804.24 20910804.24 0.00 29696.27 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 352.1 100.00% 59392.18 28955 158171 59414.70 51152 68938 20910804 20910804 0.00
 
 

Action details: bloodlet

Static Values
  • id:207690
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207690
  • name:Bloodlet
  • school:physical
  • tooltip:Inflicts $w1 damage every $t1 sec.
  • description:{$@spelldesc206473=Throw Glaive causes targets to bleed for {$s1=150}% of the damage inflicted over {$207690d=10 seconds}. If this effect is reapplied, any remaining damage will be added to the new Bloodlet.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vengeful Retreat 5394 1.0% 25.4 15.89sec 84046 0 Direct 88.8 17384 34768 24092 38.6% 0.0%  

Stats details: vengeful_retreat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.45 88.77 0.00 0.00 0.0000 0.0000 2138610.05 3143959.35 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.52 61.41% 17383.68 17128 17993 17383.53 17183 17630 947676 1393174 31.98
crit 34.25 38.59% 34768.02 34256 35986 34767.67 34256 35357 1190934 1750785 31.98
 
 

Action details: vengeful_retreat

Static Values
  • id:198793
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Spelldata
  • id:198793
  • name:Vengeful Retreat
  • school:physical
  • tooltip:
  • description:Remove all snares and vault away. Nearby enemies take $198813sw2 Physical damage and have their movement speed reduced by {$198813s1=70}% for {$198813d=3 seconds}.$?a203551[ |cFFFFFFFFGenerates $203650o1 Fury over {$203650d=5 seconds} if you damage an enemy.|r][]
 
Simple Action Stats Execute Interval
Mortwraith
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mortwraith
  • harmful:false
  • if_expr:
 
Blur 0.1 179.85sec

Stats details: blur

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.14 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blur

Static Values
  • id:198589
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
Spelldata
  • id:198589
  • name:Blur
  • school:physical
  • tooltip:
  • description:Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.
 
Consume Magic 12.6 32.59sec

Stats details: consume_magic

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.61 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: consume_magic

Static Values
  • id:183752
  • school:chromatic
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:183752
  • name:Consume Magic
  • school:chromatic
  • tooltip:
  • description:Interrupts the enemy's spellcasting and locks them from that school of magic for {$d=3 seconds}.|cFFFFFFFF{$?s178940=false}[ Generates {$218903s1=50} Fury on a successful interrupt.][ Generates ${{$218903s2=500}/10} Pain on a successful interrupt.]|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mortwraith
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mortwraith
  • harmful:false
  • if_expr:
 
Metamorphosis 1.0 241.60sec

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.01 0.00 0.00 0.00 1.2665 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: metamorphosis

Static Values
  • id:191427
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:240.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191427
  • name:Metamorphosis
  • school:physical
  • tooltip:
  • description:Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blade Dance 18.3 0.0 15.6sec 15.6sec 4.64% 4.64% 0.0(0.0) 18.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_blade_dance
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • blade_dance_1:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188499
  • name:Blade Dance
  • tooltip:Dodge chance increased by {$s2=100}%.
  • description:Strike all nearby enemies for ${$sw2+2*$199552sw2+$200685sw2} Physical damage, and increase your chance to dodge by {$s2=100}% for {$d=1 second}.
  • max_stacks:0
  • duration:1.00
  • cooldown:10.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 9.50% 0.0(0.0) 1.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blur 0.1 0.0 155.2sec 155.2sec 0.36% 0.36% 0.0(0.0) 0.1

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_blur
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.35

Stack Uptimes

  • blur_1:0.36%

Trigger Attempt Success

  • trigger_pct:14.04%

Spelldata details

  • id:212800
  • name:Blur
  • tooltip:Dodge increased by {$s2=50}%. All damage reduced by {$s3=35}%.
  • description:{$@spelldesc198589=Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
Death Sweep 5.4 0.0 56.8sec 56.8sec 1.36% 1.36% 0.0(0.0) 5.4

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_death_sweep
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • death_sweep_1:1.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210152
  • name:Death Sweep
  • tooltip:Dodge chance increased by {$s3=0}%.
  • description:Strike all nearby enemies for ${3*$210153sw2+$210155sw2} Physical damage, and increase your Dodge chance by {$s2=100}% for {$d=1 second}.
  • max_stacks:0
  • duration:1.00
  • cooldown:8.00
  • default_chance:0.00%
fel_rush_movement 1.7 0.0 147.4sec 147.4sec 0.11% 0.11% 0.0(0.0) 1.7

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_fel_rush_movement
  • max_stacks:1
  • duration:0.25
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fel_rush_movement_1:0.11%

Trigger Attempt Success

  • trigger_pct:94.67%
Metamorphosis 12.3 0.3 33.7sec 31.0sec 20.37% 19.48% 0.3(0.3) 12.2

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • metamorphosis_1:20.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162264
  • name:Metamorphosis
  • tooltip:Chaos Strike and Blade Dance upgraded to $@spellname201427 and $@spellname210152. Haste increased by {$s7=25}%.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Momentum 58.4 1.5 6.9sec 6.8sec 58.70% 64.44% 1.5(1.5) 57.8

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_momentum
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • momentum_1:58.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208628
  • name:Momentum
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Increases all damage done by {$s1=20}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
out_of_range 26.1 26.1 15.4sec 7.6sec 2.29% 2.29% 26.1(26.1) 0.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_out_of_range
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • out_of_range_1:2.29%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of the Old War 2.0 0.0 244.6sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Prepared 25.4 0.0 15.9sec 15.9sec 31.56% 31.56% 252.6(252.6) 25.1

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_prepared
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • prepared_1:31.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203650
  • name:Prepared
  • tooltip:Generating ${$m1*2} Fury every sec.
  • description:{$@spelldesc203551=Reduces the cooldown of Vengeful Retreat by 10 sec, and generates $203650o1 Fury over {$203650d=5 seconds} if you damage at least one enemy with Vengeful Retreat.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Rage of the Illidari 7.1 441.1 60.5sec 0.8sec 5.29% 5.29% 441.1(441.1) 0.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_rage_of_the_illidari
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rage_of_the_illidari_1:5.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:217060
  • name:Rage of the Illidari
  • tooltip:
  • description:{$@spelldesc201472=When Fury of the Illidari ends, {$s1=60}% of the damage it dealt erupts in an explosion of fel energy, dividing that Chaos damage among all neaby enemies.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 10.00% 10.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:10.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Rapid Adaptation 7.1 0.0 60.5sec 60.5sec 34.83% 34.83% 0.0(0.0) 6.8

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_rapid_adaptation
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:2154.27

Stack Uptimes

  • rapid_adaptation_1:34.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:170397
  • name:Rapid Adaptation
  • tooltip:Increases Versatility by {$s1=2036}.
  • description:Increases Versatility by {$s1=2036} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
vengeful_retreat_movement 25.4 0.0 15.9sec 15.9sec 6.34% 6.34% 0.0(0.0) 25.4

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_vengeful_retreat_movement
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vengeful_retreat_movement_1:6.34%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mortwraith
annihilation Fury 17.3 693.9 40.0 40.0 9708.9
blade_dance Fury 18.3 640.7 35.0 35.0 29079.8
chaos_strike Fury 77.3 3092.1 40.0 40.0 7382.2
death_sweep Fury 5.4 188.3 35.0 35.0 44481.0
eye_beam Fury 11.8 591.3 50.0 50.0 66221.2
Resource Gains Type Count Total Average Overflow
prepared Fury 252.64 976.62 (18.58%) 3.87 33.95 3.36%
fel_rush_dmg Fury 34.41 851.63 (16.20%) 24.75 8.52 0.99%
consume_magic Fury 12.61 477.75 (9.09%) 37.89 152.72 24.22%
annihilation Fury 6.69 133.89 (2.55%) 20.00 0.00 0.00%
demons_bite Fury 88.94 2222.08 (42.27%) 24.98 1.11 0.05%
chaos_strike Fury 29.75 595.00 (11.32%) 20.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Fury 13.12 13.00
Combat End Resource Mean Min Max
Fury 50.73 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %
Fury Cap 1.8%

Procs

Count Interval
delayed_swing__out_of_range 5.0 97.9sec
delayed_swing__channeling 25.5 31.6sec
demons_bite_in_meta 18.9 15.5sec
fel_barrage 31.1 12.6sec

Statistics & Data Analysis

Fight Length
Sample Data Mortwraith Fight Length
Count 9999
Mean 400.62
Minimum 307.54
Maximum 499.01
Spread ( max - min ) 191.47
Range [ ( max - min ) / 2 * 100% ] 23.90%
DPS
Sample Data Mortwraith Damage Per Second
Count 9999
Mean 564037.36
Minimum 447615.33
Maximum 738498.92
Spread ( max - min ) 290883.60
Range [ ( max - min ) / 2 * 100% ] 25.79%
Standard Deviation 47699.7915
5th Percentile 495306.89
95th Percentile 647703.96
( 95th Percentile - 5th Percentile ) 152397.07
Mean Distribution
Standard Deviation 477.0218
95.00% Confidence Intervall ( 563102.42 - 564972.31 )
Normalized 95.00% Confidence Intervall ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 274
0.1% Error 27473
0.1 Scale Factor Error with Delta=300 19423014
0.05 Scale Factor Error with Delta=300 77692057
0.01 Scale Factor Error with Delta=300 1942301429
Priority Target DPS
Sample Data Mortwraith Priority Target Damage Per Second
Count 9999
Mean 235135.99
Minimum 213464.60
Maximum 264083.02
Spread ( max - min ) 50618.42
Range [ ( max - min ) / 2 * 100% ] 10.76%
Standard Deviation 6997.5187
5th Percentile 224196.28
95th Percentile 247247.68
( 95th Percentile - 5th Percentile ) 23051.40
Mean Distribution
Standard Deviation 69.9787
95.00% Confidence Intervall ( 234998.84 - 235273.15 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3402
0.1 Scale Factor Error with Delta=300 417995
0.05 Scale Factor Error with Delta=300 1671982
0.01 Scale Factor Error with Delta=300 41799569
DPS(e)
Sample Data Mortwraith Damage Per Second (Effective)
Count 9999
Mean 564037.36
Minimum 447615.33
Maximum 738498.92
Spread ( max - min ) 290883.60
Range [ ( max - min ) / 2 * 100% ] 25.79%
Damage
Sample Data Mortwraith Damage
Count 9999
Mean 223896147.48
Minimum 184468034.05
Maximum 265217009.96
Spread ( max - min ) 80748975.91
Range [ ( max - min ) / 2 * 100% ] 18.03%
DTPS
Sample Data Mortwraith Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mortwraith Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mortwraith Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mortwraith Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mortwraith Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mortwraith Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MortwraithTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mortwraith Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
5 0.00 metamorphosis
Default action list Executed every time the actor is available.
# count action,conditions
6 47.74 auto_attack
0.00 variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
"Getting ready to use meta" conditions, this is used in a few places.
0.00 variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
0.00 variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on # single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
7 0.14 blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
8 0.00 call_action_list,name=cooldown
9 1.00 fel_rush,animation_cancel=1,if=time=0
Fel Rush in at the start of combat.
0.00 pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
A 12.61 consume_magic
B 25.46 vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Vengeful Retreat backwards through the target to minimize downtime.
C 31.66 fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
Fel Rush for Momentum and for fury from Fel Mastery.
D 4.85 fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
E 2.99 throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
F 7.08 fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
0.00 eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
G 5.38 death_sweep,if=variable.blade_dance
H 18.35 blade_dance,if=variable.blade_dance
I 22.58 throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
0.00 fel_eruption
0.00 felblade,if=fury.deficit>=30+buff.prepared.up*8
J 17.35 annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
K 10.02 throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
L 11.83 eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
M 7.03 throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
N 77.30 chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
O 5.23 fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
0.00 fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
P 88.94 demons_bite
Q 5.29 throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
0.00 felblade,if=movement.distance|buff.out_of_range.up
R 1.75 fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
0.00 vengeful_retreat,if=movement.distance>15
actions.cooldown
# count action,conditions
S 7.40 use_item,slot=trinket2,if=buff.chaos_blades.up|!talent.chaos_blades.enabled
0.00 nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
0.00 nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
0.00 nemesis,sync=metamorphosis,if=!raid_event.adds.exists
0.00 chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
T 1.01 metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
U 1.00 potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

Sample Sequence

012456S9D6EAFJBKPJJJPPCJJQ6PJPPJPJBEIR6GL6PPJGPCI6PD6HMPBPI6NPHANCNNQ6PPNB6HPIL6CPNSC6HFIBPNPNNPNNQ6ANCNI6HBP6PL6PMH6HCNPPMBNNNCNNP6PCI6HAL6BPINSNHF6CDIPPNBNPNCNPN6CIPHMPBPL6O6AHMC6NPNPPBNNOCNII6CHPL6BPPSIHFPN6NANCDNNBPNPMM6HC6LANPMBPHNCNPI6PNPNABDNNCI6HPL6CIPPSTUBGFPIJAGPJC6JPJPPBJQR6GPAIJPGC6JPIO6BHPPMLPCNQ6NPABNR6HNIPNPP6HSPMBFNNCNNKPN6PL6BD6KPCNNNPANQ6PNBNNPCKNNPPN6PCKNNBN6PNPCKSLC6FNKPBPNNANPPNC6KDNPBKNNCN

Sample Sequence Table

time name target resources buffs
Pre flask Mortwraith 0.0/100: 0% fury
Pre food Mortwraith 0.0/100: 0% fury
Pre augmentation Mortwraith 0.0/100: 0% fury
Pre potion Fluffy_Pillow 0.0/100: 0% fury potion_of_the_old_war
0:00.000 metamorphosis Fluffy_Pillow 0.0/100: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/100: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 0.0/100: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 fel_rush Fluffy_Pillow 0.0/100: 0% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
0:00.352 fel_barrage Fluffy_Pillow 25.0/100: 25% fury metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:01.627 auto_attack Fluffy_Pillow 25.0/100: 25% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:01.627 throw_glaive Fluffy_Pillow 25.0/100: 25% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:02.478 consume_magic Fluffy_Pillow 25.0/100: 25% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:02.478 fury_of_the_illidari Fluffy_Pillow 75.0/100: 75% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:03.330 annihilation Fluffy_Pillow 75.0/100: 75% fury bloodlust, metamorphosis, momentum, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
0:04.180 vengeful_retreat Fluffy_Pillow 35.0/100: 35% fury bloodlust, metamorphosis, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
0:04.180 throw_glaive Fluffy_Pillow 35.0/100: 35% fury bloodlust, metamorphosis, momentum, prepared, rage_of_the_illidari, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
0:05.030 demons_bite Fluffy_Pillow 39.0/100: 39% fury bloodlust, metamorphosis, momentum, prepared, rage_of_the_illidari, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
0:05.880 annihilation Fluffy_Pillow 69.0/100: 69% fury bloodlust, metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
0:06.730 annihilation Fluffy_Pillow 57.0/100: 57% fury bloodlust, metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
0:07.579 annihilation Fluffy_Pillow 41.0/100: 41% fury bloodlust, metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
0:08.427 demons_bite Fluffy_Pillow 9.0/100: 9% fury bloodlust, metamorphosis, prepared, potion_of_the_old_war, rapid_adaptation
0:09.278 demons_bite Fluffy_Pillow 42.0/100: 42% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:10.129 fel_rush Fluffy_Pillow 70.0/100: 70% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:10.551 annihilation Fluffy_Pillow 95.0/100: 95% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:11.403 annihilation Fluffy_Pillow 55.0/100: 55% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:12.254 throw_glaive Fluffy_Pillow 35.0/100: 35% fury bloodlust, raid_movement, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:13.103 auto_attack Fluffy_Pillow 35.0/100: 35% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:13.103 demons_bite Fluffy_Pillow 35.0/100: 35% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:13.953 annihilation Fluffy_Pillow 61.0/100: 61% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:14.801 demons_bite Fluffy_Pillow 41.0/100: 41% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:15.651 demons_bite Fluffy_Pillow 63.0/100: 63% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:16.501 annihilation Fluffy_Pillow 90.0/100: 90% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:17.352 demons_bite Fluffy_Pillow 50.0/100: 50% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:18.204 annihilation Fluffy_Pillow 80.0/100: 80% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:19.054 vengeful_retreat Fluffy_Pillow 60.0/100: 60% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:19.180 throw_glaive Fluffy_Pillow 60.0/100: 60% fury bloodlust, metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
0:20.030 throw_glaive Fluffy_Pillow 64.0/100: 64% fury bloodlust, raid_movement, metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war
0:20.882 fel_rush Fluffy_Pillow 72.0/100: 72% fury bloodlust, raid_movement, metamorphosis, momentum, prepared, potion_of_the_old_war
0:21.279 Waiting 0.500 sec 100.0/100: 100% fury bloodlust, metamorphosis, momentum, out_of_range, prepared, potion_of_the_old_war
0:21.779 auto_attack Fluffy_Pillow 100.0/100: 100% fury bloodlust, metamorphosis, momentum, prepared, potion_of_the_old_war
0:21.779 death_sweep Fluffy_Pillow 100.0/100: 100% fury bloodlust, metamorphosis, momentum, prepared, potion_of_the_old_war
0:22.628 eye_beam Fluffy_Pillow 69.0/100: 69% fury bloodlust, metamorphosis, death_sweep, momentum, prepared, potion_of_the_old_war
0:24.112 auto_attack Fluffy_Pillow 31.0/100: 31% fury bloodlust, metamorphosis, momentum, prepared
0:24.112 demons_bite Fluffy_Pillow 31.0/100: 31% fury bloodlust, metamorphosis, momentum, prepared
0:24.963 demons_bite Fluffy_Pillow 56.0/100: 56% fury bloodlust, metamorphosis
0:25.814 annihilation Fluffy_Pillow 80.0/100: 80% fury bloodlust, metamorphosis
0:26.666 death_sweep Fluffy_Pillow 40.0/100: 40% fury bloodlust, metamorphosis
0:27.516 demons_bite Fluffy_Pillow 5.0/100: 5% fury bloodlust, metamorphosis, death_sweep
0:28.366 fel_rush Fluffy_Pillow 30.0/100: 30% fury bloodlust, raid_movement, metamorphosis
0:28.812 throw_glaive Fluffy_Pillow 55.0/100: 55% fury bloodlust, raid_movement, metamorphosis, momentum
0:29.662 auto_attack Fluffy_Pillow 55.0/100: 55% fury bloodlust, metamorphosis, momentum
0:29.662 demons_bite Fluffy_Pillow 55.0/100: 55% fury bloodlust, metamorphosis, momentum
0:30.514 fel_barrage Fluffy_Pillow 79.0/100: 79% fury bloodlust, momentum
0:31.720 auto_attack Fluffy_Pillow 79.0/100: 79% fury bloodlust, momentum
0:31.720 blade_dance Fluffy_Pillow 79.0/100: 79% fury bloodlust, momentum
0:32.783 throw_glaive Fluffy_Pillow 44.0/100: 44% fury bloodlust
0:33.845 demons_bite Fluffy_Pillow 44.0/100: 44% fury bloodlust
0:34.907 vengeful_retreat Fluffy_Pillow 70.0/100: 70% fury bloodlust
0:34.907 demons_bite Fluffy_Pillow 70.0/100: 70% fury bloodlust, momentum, prepared, vengeful_retreat_movement
0:35.969 throw_glaive Fluffy_Pillow 100.0/100: 100% fury bloodlust, momentum, out_of_range, prepared
0:37.180 auto_attack Fluffy_Pillow 100.0/100: 100% fury bloodlust, momentum, prepared
0:37.180 chaos_strike Fluffy_Pillow 100.0/100: 100% fury bloodlust, momentum, prepared
0:38.241 demons_bite Fluffy_Pillow 68.0/100: 68% fury bloodlust, momentum, prepared
0:39.304 blade_dance Fluffy_Pillow 100.0/100: 100% fury bloodlust, prepared
0:40.366 consume_magic Fluffy_Pillow 73.0/100: 73% fury bloodlust
0:40.366 chaos_strike Fluffy_Pillow 100.0/100: 100% fury bloodlust
0:41.428 fel_rush Fluffy_Pillow 60.0/100: 60% fury
0:41.826 chaos_strike Fluffy_Pillow 85.0/100: 85% fury momentum
0:43.207 chaos_strike Fluffy_Pillow 65.0/100: 65% fury momentum
0:44.588 throw_glaive Fluffy_Pillow 25.0/100: 25% fury raid_movement, momentum
0:45.968 auto_attack Fluffy_Pillow 25.0/100: 25% fury
0:45.968 demons_bite Fluffy_Pillow 25.0/100: 25% fury
0:47.349 demons_bite Fluffy_Pillow 53.0/100: 53% fury
0:48.729 chaos_strike Fluffy_Pillow 78.0/100: 78% fury
0:50.110 vengeful_retreat Fluffy_Pillow 58.0/100: 58% fury raid_movement
0:50.110 Waiting 0.500 sec 58.0/100: 58% fury raid_movement, momentum, prepared, vengeful_retreat_movement
0:50.610 auto_attack Fluffy_Pillow 62.0/100: 62% fury momentum, prepared, vengeful_retreat_movement
0:50.610 blade_dance Fluffy_Pillow 62.0/100: 62% fury momentum, prepared, vengeful_retreat_movement
0:51.991 demons_bite Fluffy_Pillow 35.0/100: 35% fury momentum, prepared
0:53.371 throw_glaive Fluffy_Pillow 76.0/100: 76% fury momentum, prepared
0:54.752 eye_beam Fluffy_Pillow 88.0/100: 88% fury prepared
0:56.909 auto_attack Fluffy_Pillow 42.0/100: 42% fury
0:56.909 fel_rush Fluffy_Pillow 42.0/100: 42% fury
0:57.255 demons_bite Fluffy_Pillow 67.0/100: 67% fury momentum
0:58.636 chaos_strike Fluffy_Pillow 91.0/100: 91% fury momentum
1:00.016 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 71.0/100: 71% fury raid_movement, momentum
1:00.016 Waiting 0.900 sec 71.0/100: 71% fury raid_movement, momentum, rapid_adaptation
1:00.916 fel_rush Fluffy_Pillow 71.0/100: 71% fury raid_movement, rapid_adaptation
1:01.305 auto_attack Fluffy_Pillow 96.0/100: 96% fury momentum, rapid_adaptation
1:01.305 blade_dance Fluffy_Pillow 96.0/100: 96% fury momentum, rapid_adaptation
1:02.686 fury_of_the_illidari Fluffy_Pillow 61.0/100: 61% fury momentum, rapid_adaptation
1:04.067 throw_glaive Fluffy_Pillow 61.0/100: 61% fury momentum, rage_of_the_illidari, rapid_adaptation
1:05.445 vengeful_retreat Fluffy_Pillow 61.0/100: 61% fury rage_of_the_illidari, rapid_adaptation
1:05.445 demons_bite Fluffy_Pillow 61.0/100: 61% fury momentum, prepared, rage_of_the_illidari, vengeful_retreat_movement, rapid_adaptation
1:06.826 chaos_strike Fluffy_Pillow 90.0/100: 90% fury momentum, prepared, rapid_adaptation
1:08.206 demons_bite Fluffy_Pillow 62.0/100: 62% fury momentum, prepared, rapid_adaptation
1:09.588 chaos_strike Fluffy_Pillow 99.0/100: 99% fury prepared, rapid_adaptation
1:10.967 chaos_strike Fluffy_Pillow 87.0/100: 87% fury rapid_adaptation
1:12.347 demons_bite Fluffy_Pillow 67.0/100: 67% fury rapid_adaptation
1:13.727 chaos_strike Fluffy_Pillow 95.0/100: 95% fury rapid_adaptation
1:15.108 chaos_strike Fluffy_Pillow 75.0/100: 75% fury rapid_adaptation
1:16.488 throw_glaive Fluffy_Pillow 35.0/100: 35% fury raid_movement, rapid_adaptation
1:17.869 auto_attack Fluffy_Pillow 35.0/100: 35% fury rapid_adaptation
1:17.869 consume_magic Fluffy_Pillow 35.0/100: 35% fury rapid_adaptation
1:17.869 chaos_strike Fluffy_Pillow 85.0/100: 85% fury rapid_adaptation
1:19.249 fel_rush Fluffy_Pillow 45.0/100: 45% fury rapid_adaptation
1:19.631 chaos_strike Fluffy_Pillow 70.0/100: 70% fury momentum, rapid_adaptation
1:21.013 throw_glaive Fluffy_Pillow 50.0/100: 50% fury raid_movement, momentum
1:22.394 Waiting 0.600 sec 50.0/100: 50% fury raid_movement, momentum
1:22.994 auto_attack Fluffy_Pillow 50.0/100: 50% fury momentum
1:22.994 blade_dance Fluffy_Pillow 50.0/100: 50% fury momentum
1:24.375 vengeful_retreat Fluffy_Pillow 15.0/100: 15% fury
1:24.375 demons_bite Fluffy_Pillow 15.0/100: 15% fury momentum, prepared, vengeful_retreat_movement
1:25.754 auto_attack Fluffy_Pillow 49.0/100: 49% fury momentum, prepared
1:25.754 demons_bite Fluffy_Pillow 49.0/100: 49% fury momentum, prepared
1:27.132 eye_beam Fluffy_Pillow 91.0/100: 91% fury momentum, prepared
1:29.210 auto_attack Fluffy_Pillow 57.0/100: 57% fury prepared
1:29.210 demons_bite Fluffy_Pillow 57.0/100: 57% fury prepared
1:30.590 throw_glaive Fluffy_Pillow 90.0/100: 90% fury
1:31.970 blade_dance Fluffy_Pillow 90.0/100: 90% fury
1:32.006 Waiting 1.000 sec 90.0/100: 90% fury raid_movement
1:33.006 auto_attack Fluffy_Pillow 90.0/100: 90% fury
1:33.006 blade_dance Fluffy_Pillow 90.0/100: 90% fury
1:34.386 fel_rush Fluffy_Pillow 55.0/100: 55% fury
1:34.777 chaos_strike Fluffy_Pillow 80.0/100: 80% fury momentum
1:36.158 demons_bite Fluffy_Pillow 40.0/100: 40% fury momentum
1:37.539 demons_bite Fluffy_Pillow 64.0/100: 64% fury momentum
1:38.921 throw_glaive Fluffy_Pillow 91.0/100: 91% fury
1:40.301 vengeful_retreat Fluffy_Pillow 91.0/100: 91% fury
1:40.301 chaos_strike Fluffy_Pillow 91.0/100: 91% fury momentum, prepared, vengeful_retreat_movement
1:41.682 chaos_strike Fluffy_Pillow 59.0/100: 59% fury momentum, prepared
1:43.062 chaos_strike Fluffy_Pillow 51.0/100: 51% fury momentum, prepared
1:44.443 fel_rush Fluffy_Pillow 43.0/100: 43% fury prepared
1:44.799 chaos_strike Fluffy_Pillow 68.0/100: 68% fury momentum, prepared
1:46.179 chaos_strike Fluffy_Pillow 56.0/100: 56% fury momentum
1:47.559 demons_bite Fluffy_Pillow 16.0/100: 16% fury momentum
1:48.941 auto_attack Fluffy_Pillow 41.0/100: 41% fury
1:48.941 demons_bite Fluffy_Pillow 41.0/100: 41% fury
1:50.321 fel_rush Fluffy_Pillow 71.0/100: 71% fury raid_movement
1:50.732 throw_glaive Fluffy_Pillow 96.0/100: 96% fury raid_movement, momentum
1:52.112 Waiting 0.900 sec 96.0/100: 96% fury raid_movement, momentum
1:53.012 auto_attack Fluffy_Pillow 96.0/100: 96% fury momentum
1:53.012 blade_dance Fluffy_Pillow 96.0/100: 96% fury momentum
1:54.392 consume_magic Fluffy_Pillow 61.0/100: 61% fury
1:54.392 eye_beam Fluffy_Pillow 100.0/100: 100% fury
1:56.604 auto_attack Fluffy_Pillow 50.0/100: 50% fury
1:56.604 vengeful_retreat Fluffy_Pillow 50.0/100: 50% fury
1:56.604 demons_bite Fluffy_Pillow 50.0/100: 50% fury momentum, prepared, vengeful_retreat_movement
1:57.985 throw_glaive Fluffy_Pillow 78.0/100: 78% fury momentum, prepared
1:59.366 chaos_strike Fluffy_Pillow 90.0/100: 90% fury momentum, prepared
2:00.747 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 82.0/100: 82% fury prepared
2:00.747 chaos_strike Fluffy_Pillow 82.0/100: 82% fury prepared, rapid_adaptation
2:02.127 blade_dance Fluffy_Pillow 50.0/100: 50% fury rapid_adaptation
2:03.564 fury_of_the_illidari Fluffy_Pillow 15.0/100: 15% fury rapid_adaptation
2:04.945 auto_attack Fluffy_Pillow 15.0/100: 15% fury rage_of_the_illidari, rapid_adaptation
2:04.945 fel_rush Fluffy_Pillow 15.0/100: 15% fury rage_of_the_illidari, rapid_adaptation
2:05.354 fel_barrage Fluffy_Pillow 40.0/100: 40% fury momentum, rage_of_the_illidari, rapid_adaptation
2:06.842 throw_glaive Fluffy_Pillow 40.0/100: 40% fury momentum, rapid_adaptation
2:08.221 demons_bite Fluffy_Pillow 40.0/100: 40% fury momentum, rapid_adaptation
2:09.601 demons_bite Fluffy_Pillow 64.0/100: 64% fury rapid_adaptation
2:10.981 chaos_strike Fluffy_Pillow 84.0/100: 84% fury rapid_adaptation
2:12.360 vengeful_retreat Fluffy_Pillow 44.0/100: 44% fury rapid_adaptation
2:12.360 chaos_strike Fluffy_Pillow 44.0/100: 44% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
2:13.742 demons_bite Fluffy_Pillow 12.0/100: 12% fury momentum, prepared, rapid_adaptation
2:15.122 chaos_strike Fluffy_Pillow 51.0/100: 51% fury momentum, prepared, rapid_adaptation
2:16.502 fel_rush Fluffy_Pillow 23.0/100: 23% fury prepared, rapid_adaptation
2:16.945 chaos_strike Fluffy_Pillow 52.0/100: 52% fury momentum, prepared, rapid_adaptation
2:18.326 demons_bite Fluffy_Pillow 16.0/100: 16% fury momentum, rapid_adaptation
2:19.708 chaos_strike Fluffy_Pillow 40.0/100: 40% fury momentum, rapid_adaptation
2:21.091 auto_attack Fluffy_Pillow 0.0/100: 0% fury
2:21.091 fel_rush Fluffy_Pillow 0.0/100: 0% fury
2:21.463 throw_glaive Fluffy_Pillow 25.0/100: 25% fury momentum
2:22.844 demons_bite Fluffy_Pillow 25.0/100: 25% fury momentum
2:24.225 blade_dance Fluffy_Pillow 45.0/100: 45% fury momentum
2:25.605 throw_glaive Fluffy_Pillow 10.0/100: 10% fury
2:26.985 demons_bite Fluffy_Pillow 10.0/100: 10% fury
2:28.365 vengeful_retreat Fluffy_Pillow 36.0/100: 36% fury
2:28.365 demons_bite Fluffy_Pillow 36.0/100: 36% fury momentum, prepared, vengeful_retreat_movement
2:29.747 eye_beam Fluffy_Pillow 72.0/100: 72% fury momentum, prepared
2:31.993 auto_attack Fluffy_Pillow 42.0/100: 42% fury momentum, prepared
2:31.993 fel_barrage Fluffy_Pillow 42.0/100: 42% fury momentum, prepared
2:33.570 auto_attack Fluffy_Pillow 54.0/100: 54% fury
2:33.570 consume_magic Fluffy_Pillow 54.0/100: 54% fury
2:33.570 blade_dance Fluffy_Pillow 100.0/100: 100% fury
2:34.949 throw_glaive Fluffy_Pillow 65.0/100: 65% fury
2:36.331 fel_rush Fluffy_Pillow 65.0/100: 65% fury raid_movement
2:36.768 Waiting 0.200 sec 90.0/100: 90% fury raid_movement, momentum
2:36.968 auto_attack Fluffy_Pillow 90.0/100: 90% fury momentum
2:36.968 chaos_strike Fluffy_Pillow 90.0/100: 90% fury momentum
2:38.349 demons_bite Fluffy_Pillow 50.0/100: 50% fury momentum
2:39.729 chaos_strike Fluffy_Pillow 79.0/100: 79% fury momentum
2:41.110 demons_bite Fluffy_Pillow 39.0/100: 39% fury
2:42.491 demons_bite Fluffy_Pillow 60.0/100: 60% fury
2:43.870 vengeful_retreat Fluffy_Pillow 86.0/100: 86% fury
2:43.870 chaos_strike Fluffy_Pillow 86.0/100: 86% fury momentum, prepared, vengeful_retreat_movement
2:45.252 chaos_strike Fluffy_Pillow 54.0/100: 54% fury momentum, prepared
2:46.633 fel_barrage Fluffy_Pillow 26.0/100: 26% fury momentum, prepared
2:48.361 fel_rush Fluffy_Pillow 38.0/100: 38% fury prepared
2:48.784 chaos_strike Fluffy_Pillow 67.0/100: 67% fury momentum, prepared
2:50.166 throw_glaive Fluffy_Pillow 51.0/100: 51% fury raid_movement, momentum
2:51.546 Waiting 0.500 sec 51.0/100: 51% fury raid_movement, momentum
2:52.046 throw_glaive Fluffy_Pillow 51.0/100: 51% fury raid_movement, momentum
2:53.627 auto_attack Fluffy_Pillow 51.0/100: 51% fury
2:53.627 fel_rush Fluffy_Pillow 51.0/100: 51% fury
2:54.022 blade_dance Fluffy_Pillow 76.0/100: 76% fury momentum
2:55.403 demons_bite Fluffy_Pillow 41.0/100: 41% fury momentum
2:56.784 eye_beam Fluffy_Pillow 64.0/100: 64% fury momentum
2:58.849 auto_attack Fluffy_Pillow 14.0/100: 14% fury
2:58.849 vengeful_retreat Fluffy_Pillow 14.0/100: 14% fury
2:58.870 demons_bite Fluffy_Pillow 14.0/100: 14% fury momentum, prepared, vengeful_retreat_movement
3:00.252 demons_bite Fluffy_Pillow 51.0/100: 51% fury momentum, prepared
3:01.632 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 89.0/100: 89% fury momentum, prepared
3:01.632 throw_glaive Fluffy_Pillow 89.0/100: 89% fury momentum, prepared, rapid_adaptation
3:03.012 blade_dance Fluffy_Pillow 100.0/100: 100% fury prepared, rapid_adaptation
3:04.576 fury_of_the_illidari Fluffy_Pillow 73.0/100: 73% fury rapid_adaptation
3:05.956 demons_bite Fluffy_Pillow 73.0/100: 73% fury rage_of_the_illidari, rapid_adaptation
3:07.336 chaos_strike Fluffy_Pillow 100.0/100: 100% fury rage_of_the_illidari, rapid_adaptation
3:08.716 Waiting 0.300 sec 80.0/100: 80% fury raid_movement, rapid_adaptation
3:09.016 auto_attack Fluffy_Pillow 80.0/100: 80% fury rapid_adaptation
3:09.016 chaos_strike Fluffy_Pillow 80.0/100: 80% fury rapid_adaptation
3:10.396 consume_magic Fluffy_Pillow 40.0/100: 40% fury rapid_adaptation
3:10.396 chaos_strike Fluffy_Pillow 90.0/100: 90% fury rapid_adaptation
3:11.777 fel_rush Fluffy_Pillow 50.0/100: 50% fury rapid_adaptation
3:12.172 fel_barrage Fluffy_Pillow 75.0/100: 75% fury momentum, rapid_adaptation
3:13.820 chaos_strike Fluffy_Pillow 75.0/100: 75% fury momentum, rapid_adaptation
3:15.200 chaos_strike Fluffy_Pillow 55.0/100: 55% fury momentum, rapid_adaptation
3:16.579 vengeful_retreat Fluffy_Pillow 15.0/100: 15% fury rapid_adaptation
3:16.579 demons_bite Fluffy_Pillow 15.0/100: 15% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
3:17.961 chaos_strike Fluffy_Pillow 46.0/100: 46% fury momentum, prepared, rapid_adaptation
3:19.341 demons_bite Fluffy_Pillow 38.0/100: 38% fury momentum, prepared, rapid_adaptation
3:20.722 throw_glaive Fluffy_Pillow 80.0/100: 80% fury raid_movement, prepared, rapid_adaptation
3:22.104 throw_glaive Fluffy_Pillow 88.0/100: 88% fury raid_movement
3:23.484 auto_attack Fluffy_Pillow 88.0/100: 88% fury
3:23.484 blade_dance Fluffy_Pillow 88.0/100: 88% fury
3:24.864 fel_rush Fluffy_Pillow 53.0/100: 53% fury raid_movement
3:25.251 auto_attack Fluffy_Pillow 78.0/100: 78% fury momentum
3:25.251 eye_beam Fluffy_Pillow 78.0/100: 78% fury momentum
3:27.426 consume_magic Fluffy_Pillow 28.0/100: 28% fury momentum
3:27.426 chaos_strike Fluffy_Pillow 78.0/100: 78% fury momentum
3:28.806 demons_bite Fluffy_Pillow 38.0/100: 38% fury momentum
3:30.186 throw_glaive Fluffy_Pillow 65.0/100: 65% fury
3:31.567 vengeful_retreat Fluffy_Pillow 65.0/100: 65% fury
3:31.579 demons_bite Fluffy_Pillow 65.0/100: 65% fury momentum, prepared, vengeful_retreat_movement
3:32.960 blade_dance Fluffy_Pillow 100.0/100: 100% fury momentum, prepared
3:34.342 chaos_strike Fluffy_Pillow 77.0/100: 77% fury momentum, prepared
3:35.722 fel_rush Fluffy_Pillow 49.0/100: 49% fury prepared
3:36.112 chaos_strike Fluffy_Pillow 78.0/100: 78% fury momentum, prepared
3:37.492 demons_bite Fluffy_Pillow 42.0/100: 42% fury momentum
3:38.872 throw_glaive Fluffy_Pillow 65.0/100: 65% fury momentum
3:40.449 Waiting 0.500 sec 65.0/100: 65% fury raid_movement
3:40.949 auto_attack Fluffy_Pillow 65.0/100: 65% fury
3:40.949 demons_bite Fluffy_Pillow 65.0/100: 65% fury
3:42.329 chaos_strike Fluffy_Pillow 95.0/100: 95% fury
3:43.710 demons_bite Fluffy_Pillow 55.0/100: 55% fury
3:45.090 chaos_strike Fluffy_Pillow 79.0/100: 79% fury
3:46.471 consume_magic Fluffy_Pillow 39.0/100: 39% fury
3:46.471 vengeful_retreat Fluffy_Pillow 89.0/100: 89% fury
3:46.579 fel_barrage Fluffy_Pillow 89.0/100: 89% fury momentum, prepared, vengeful_retreat_movement
3:48.232 chaos_strike Fluffy_Pillow 100.0/100: 100% fury momentum, prepared
3:49.613 chaos_strike Fluffy_Pillow 72.0/100: 72% fury momentum, prepared
3:50.992 fel_rush Fluffy_Pillow 40.0/100: 40% fury raid_movement, prepared
3:51.433 throw_glaive Fluffy_Pillow 69.0/100: 69% fury raid_movement, momentum, prepared
3:52.814 Waiting 0.200 sec 73.0/100: 73% fury raid_movement, momentum
3:53.014 auto_attack Fluffy_Pillow 73.0/100: 73% fury momentum
3:53.014 blade_dance Fluffy_Pillow 73.0/100: 73% fury momentum
3:54.395 demons_bite Fluffy_Pillow 38.0/100: 38% fury momentum
3:55.775 eye_beam Fluffy_Pillow 58.0/100: 58% fury
3:57.397 auto_attack Fluffy_Pillow 8.0/100: 8% fury metamorphosis
3:57.397 fel_rush Fluffy_Pillow 8.0/100: 8% fury metamorphosis
3:57.801 throw_glaive Fluffy_Pillow 33.0/100: 33% fury momentum
3:59.183 demons_bite Fluffy_Pillow 33.0/100: 33% fury momentum
4:00.563 demons_bite Fluffy_Pillow 58.0/100: 58% fury momentum
4:01.944 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 79.0/100: 79% fury
4:01.944 metamorphosis Fluffy_Pillow 79.0/100: 79% fury rapid_adaptation
4:03.213 potion Fluffy_Pillow 79.0/100: 79% fury metamorphosis, rapid_adaptation
4:03.213 vengeful_retreat Fluffy_Pillow 79.0/100: 79% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:03.213 death_sweep Fluffy_Pillow 79.0/100: 79% fury metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
4:04.318 Waiting 0.200 sec 52.0/100: 52% fury metamorphosis, momentum, out_of_range, prepared, potion_of_the_old_war, rapid_adaptation
4:04.518 fury_of_the_illidari Fluffy_Pillow 52.0/100: 52% fury metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:05.680 demons_bite Fluffy_Pillow 60.0/100: 60% fury metamorphosis, momentum, prepared, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
4:06.785 throw_glaive Fluffy_Pillow 99.0/100: 99% fury metamorphosis, momentum, prepared, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
4:07.889 annihilation Fluffy_Pillow 100.0/100: 100% fury metamorphosis, prepared, potion_of_the_old_war, rapid_adaptation
4:08.993 consume_magic Fluffy_Pillow 64.0/100: 64% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:08.993 death_sweep Fluffy_Pillow 100.0/100: 100% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:10.189 demons_bite Fluffy_Pillow 65.0/100: 65% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:11.294 annihilation Fluffy_Pillow 94.0/100: 94% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:12.397 fel_rush Fluffy_Pillow 54.0/100: 54% fury raid_movement, metamorphosis, potion_of_the_old_war, rapid_adaptation
4:12.768 Waiting 0.200 sec 79.0/100: 79% fury raid_movement, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
4:12.968 auto_attack Fluffy_Pillow 79.0/100: 79% fury metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
4:12.968 annihilation Fluffy_Pillow 79.0/100: 79% fury metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
4:14.071 demons_bite Fluffy_Pillow 39.0/100: 39% fury metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
4:15.175 annihilation Fluffy_Pillow 69.0/100: 69% fury metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
4:16.278 demons_bite Fluffy_Pillow 29.0/100: 29% fury metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
4:17.384 demons_bite Fluffy_Pillow 50.0/100: 50% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:18.489 vengeful_retreat Fluffy_Pillow 73.0/100: 73% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:18.489 annihilation Fluffy_Pillow 73.0/100: 73% fury metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
4:19.593 throw_glaive Fluffy_Pillow 41.0/100: 41% fury metamorphosis, momentum, out_of_range, prepared, potion_of_the_old_war, rapid_adaptation
4:20.700 fel_rush Fluffy_Pillow 49.0/100: 49% fury raid_movement, metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:21.062 Waiting 0.500 sec 78.0/100: 78% fury metamorphosis, momentum, out_of_range, prepared, potion_of_the_old_war, rapid_adaptation
4:21.562 auto_attack Fluffy_Pillow 82.0/100: 82% fury metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:21.562 death_sweep Fluffy_Pillow 82.0/100: 82% fury metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:22.665 demons_bite Fluffy_Pillow 55.0/100: 55% fury metamorphosis, momentum, prepared, potion_of_the_old_war
4:23.769 consume_magic Fluffy_Pillow 93.0/100: 93% fury metamorphosis, momentum, potion_of_the_old_war
4:23.993 throw_glaive Fluffy_Pillow 100.0/100: 100% fury metamorphosis, momentum, potion_of_the_old_war
4:25.096 annihilation Fluffy_Pillow 100.0/100: 100% fury metamorphosis, potion_of_the_old_war
4:26.202 demons_bite Fluffy_Pillow 60.0/100: 60% fury metamorphosis, potion_of_the_old_war
4:27.309 death_sweep Fluffy_Pillow 87.0/100: 87% fury metamorphosis, potion_of_the_old_war
4:28.536 fel_rush Fluffy_Pillow 52.0/100: 52% fury raid_movement, metamorphosis
4:28.934 Waiting 0.100 sec 77.0/100: 77% fury raid_movement, metamorphosis, momentum
4:29.034 auto_attack Fluffy_Pillow 77.0/100: 77% fury metamorphosis, momentum
4:29.034 annihilation Fluffy_Pillow 77.0/100: 77% fury metamorphosis, momentum
4:30.139 demons_bite Fluffy_Pillow 37.0/100: 37% fury metamorphosis, momentum
4:31.243 throw_glaive Fluffy_Pillow 60.0/100: 60% fury metamorphosis, momentum
4:32.346 fel_barrage Fluffy_Pillow 60.0/100: 60% fury momentum
4:34.027 auto_attack Fluffy_Pillow 60.0/100: 60% fury
4:34.027 vengeful_retreat Fluffy_Pillow 60.0/100: 60% fury
4:34.027 blade_dance Fluffy_Pillow 60.0/100: 60% fury momentum, prepared, vengeful_retreat_movement
4:35.407 demons_bite Fluffy_Pillow 33.0/100: 33% fury momentum, prepared
4:36.786 demons_bite Fluffy_Pillow 65.0/100: 65% fury momentum, prepared
4:38.167 throw_glaive Fluffy_Pillow 100.0/100: 100% fury prepared
4:39.548 eye_beam Fluffy_Pillow 100.0/100: 100% fury
4:41.631 demons_bite Fluffy_Pillow 50.0/100: 50% fury
4:43.013 fel_rush Fluffy_Pillow 75.0/100: 75% fury
4:43.441 chaos_strike Fluffy_Pillow 100.0/100: 100% fury momentum
4:44.820 Waiting 0.100 sec 60.0/100: 60% fury raid_movement, momentum
4:44.920 throw_glaive Fluffy_Pillow 60.0/100: 60% fury raid_movement, momentum
4:46.497 auto_attack Fluffy_Pillow 60.0/100: 60% fury momentum
4:46.497 chaos_strike Fluffy_Pillow 60.0/100: 60% fury momentum
4:47.879 demons_bite Fluffy_Pillow 20.0/100: 20% fury
4:49.261 consume_magic Fluffy_Pillow 50.0/100: 50% fury
4:49.261 vengeful_retreat Fluffy_Pillow 100.0/100: 100% fury
4:49.261 chaos_strike Fluffy_Pillow 100.0/100: 100% fury momentum, prepared, vengeful_retreat_movement
4:50.640 fel_rush Fluffy_Pillow 68.0/100: 68% fury raid_movement, momentum, prepared
4:51.047 Waiting 0.500 sec 97.0/100: 97% fury momentum, out_of_range, prepared
4:51.547 auto_attack Fluffy_Pillow 100.0/100: 100% fury momentum, prepared
4:51.547 blade_dance Fluffy_Pillow 100.0/100: 100% fury momentum, prepared
4:52.928 chaos_strike Fluffy_Pillow 77.0/100: 77% fury momentum, prepared
4:54.309 throw_glaive Fluffy_Pillow 49.0/100: 49% fury momentum
4:55.690 demons_bite Fluffy_Pillow 49.0/100: 49% fury
4:57.070 chaos_strike Fluffy_Pillow 76.0/100: 76% fury
4:58.449 demons_bite Fluffy_Pillow 36.0/100: 36% fury
4:59.829 demons_bite Fluffy_Pillow 60.0/100: 60% fury
5:01.209 auto_attack Fluffy_Pillow 89.0/100: 89% fury
5:01.209 blade_dance Fluffy_Pillow 89.0/100: 89% fury
5:02.590 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 54.0/100: 54% fury
5:02.590 demons_bite Fluffy_Pillow 54.0/100: 54% fury rapid_adaptation
5:03.970 throw_glaive Fluffy_Pillow 82.0/100: 82% fury rapid_adaptation
5:05.350 vengeful_retreat Fluffy_Pillow 82.0/100: 82% fury rapid_adaptation
5:05.350 fury_of_the_illidari Fluffy_Pillow 82.0/100: 82% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
5:06.731 chaos_strike Fluffy_Pillow 90.0/100: 90% fury momentum, prepared, rage_of_the_illidari, rapid_adaptation
5:08.112 chaos_strike Fluffy_Pillow 82.0/100: 82% fury momentum, prepared, rage_of_the_illidari, rapid_adaptation
5:09.492 fel_rush Fluffy_Pillow 54.0/100: 54% fury prepared, rapid_adaptation
5:09.872 chaos_strike Fluffy_Pillow 83.0/100: 83% fury momentum, prepared, rapid_adaptation
5:11.252 chaos_strike Fluffy_Pillow 67.0/100: 67% fury momentum, rapid_adaptation
5:12.634 throw_glaive Fluffy_Pillow 47.0/100: 47% fury momentum, rapid_adaptation
5:14.015 demons_bite Fluffy_Pillow 47.0/100: 47% fury rapid_adaptation
5:15.396 chaos_strike Fluffy_Pillow 75.0/100: 75% fury rapid_adaptation
5:16.775 Waiting 0.200 sec 35.0/100: 35% fury raid_movement, rapid_adaptation
5:16.975 auto_attack Fluffy_Pillow 35.0/100: 35% fury rapid_adaptation
5:16.975 demons_bite Fluffy_Pillow 35.0/100: 35% fury rapid_adaptation
5:18.355 eye_beam Fluffy_Pillow 58.0/100: 58% fury rapid_adaptation
5:20.669 auto_attack Fluffy_Pillow 8.0/100: 8% fury rapid_adaptation
5:20.669 vengeful_retreat Fluffy_Pillow 8.0/100: 8% fury rapid_adaptation
5:20.669 fel_barrage Fluffy_Pillow 8.0/100: 8% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
5:22.312 auto_attack Fluffy_Pillow 20.0/100: 20% fury momentum, prepared, rapid_adaptation
5:22.312 throw_glaive Fluffy_Pillow 20.0/100: 20% fury momentum, prepared, rapid_adaptation
5:23.693 demons_bite Fluffy_Pillow 32.0/100: 32% fury momentum, prepared
5:25.076 fel_rush Fluffy_Pillow 60.0/100: 60% fury prepared
5:25.463 chaos_strike Fluffy_Pillow 89.0/100: 89% fury momentum, prepared
5:26.844 chaos_strike Fluffy_Pillow 73.0/100: 73% fury momentum
5:28.225 chaos_strike Fluffy_Pillow 53.0/100: 53% fury momentum
5:29.606 demons_bite Fluffy_Pillow 33.0/100: 33% fury
5:30.986 consume_magic Fluffy_Pillow 58.0/100: 58% fury
5:30.986 chaos_strike Fluffy_Pillow 100.0/100: 100% fury
5:32.365 throw_glaive Fluffy_Pillow 60.0/100: 60% fury raid_movement
5:33.744 auto_attack Fluffy_Pillow 60.0/100: 60% fury
5:33.744 demons_bite Fluffy_Pillow 60.0/100: 60% fury
5:35.124 chaos_strike Fluffy_Pillow 86.0/100: 86% fury
5:36.505 vengeful_retreat Fluffy_Pillow 66.0/100: 66% fury
5:36.505 chaos_strike Fluffy_Pillow 66.0/100: 66% fury momentum, prepared, vengeful_retreat_movement
5:37.885 chaos_strike Fluffy_Pillow 54.0/100: 54% fury momentum, prepared
5:39.264 demons_bite Fluffy_Pillow 26.0/100: 26% fury momentum, prepared
5:40.643 fel_rush Fluffy_Pillow 67.0/100: 67% fury prepared
5:41.002 throw_glaive Fluffy_Pillow 92.0/100: 92% fury momentum, prepared
5:42.384 chaos_strike Fluffy_Pillow 100.0/100: 100% fury momentum
5:43.765 chaos_strike Fluffy_Pillow 80.0/100: 80% fury momentum
5:45.145 demons_bite Fluffy_Pillow 40.0/100: 40% fury
5:46.524 demons_bite Fluffy_Pillow 66.0/100: 66% fury
5:47.904 chaos_strike Fluffy_Pillow 91.0/100: 91% fury
5:49.285 auto_attack Fluffy_Pillow 51.0/100: 51% fury
5:49.285 demons_bite Fluffy_Pillow 51.0/100: 51% fury
5:50.665 fel_rush Fluffy_Pillow 75.0/100: 75% fury
5:51.083 throw_glaive Fluffy_Pillow 100.0/100: 100% fury momentum
5:52.463 chaos_strike Fluffy_Pillow 100.0/100: 100% fury momentum
5:53.843 chaos_strike Fluffy_Pillow 60.0/100: 60% fury momentum
5:55.222 vengeful_retreat Fluffy_Pillow 40.0/100: 40% fury
5:55.222 chaos_strike Fluffy_Pillow 40.0/100: 40% fury momentum, prepared, vengeful_retreat_movement
5:56.602 auto_attack Fluffy_Pillow 8.0/100: 8% fury momentum, prepared
5:56.602 demons_bite Fluffy_Pillow 8.0/100: 8% fury momentum, prepared
5:57.984 chaos_strike Fluffy_Pillow 44.0/100: 44% fury momentum, prepared
5:59.364 demons_bite Fluffy_Pillow 16.0/100: 16% fury prepared
6:00.745 fel_rush Fluffy_Pillow 53.0/100: 53% fury
6:01.170 throw_glaive Fluffy_Pillow 78.0/100: 78% fury momentum
6:02.551 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 78.0/100: 78% fury momentum
6:02.590 eye_beam Fluffy_Pillow 78.0/100: 78% fury momentum, rapid_adaptation
6:04.167 Waiting 0.600 sec 28.0/100: 28% fury raid_movement, metamorphosis, momentum, rapid_adaptation
6:04.767 fel_rush Fluffy_Pillow 28.0/100: 28% fury raid_movement, rapid_adaptation
6:05.229 auto_attack Fluffy_Pillow 53.0/100: 53% fury momentum, rapid_adaptation
6:05.229 fury_of_the_illidari Fluffy_Pillow 53.0/100: 53% fury momentum, rapid_adaptation
6:06.731 chaos_strike Fluffy_Pillow 53.0/100: 53% fury momentum, rage_of_the_illidari, rapid_adaptation
6:08.111 throw_glaive Fluffy_Pillow 13.0/100: 13% fury momentum, rage_of_the_illidari, rapid_adaptation
6:09.494 demons_bite Fluffy_Pillow 13.0/100: 13% fury rapid_adaptation
6:10.874 vengeful_retreat Fluffy_Pillow 34.0/100: 34% fury rapid_adaptation
6:10.874 demons_bite Fluffy_Pillow 34.0/100: 34% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
6:12.255 chaos_strike Fluffy_Pillow 69.0/100: 69% fury momentum, prepared, rapid_adaptation
6:13.636 chaos_strike Fluffy_Pillow 41.0/100: 41% fury momentum, prepared, rapid_adaptation
6:15.015 consume_magic Fluffy_Pillow 13.0/100: 13% fury prepared, rapid_adaptation
6:15.015 chaos_strike Fluffy_Pillow 63.0/100: 63% fury prepared, rapid_adaptation
6:16.396 demons_bite Fluffy_Pillow 31.0/100: 31% fury rapid_adaptation
6:17.778 demons_bite Fluffy_Pillow 52.0/100: 52% fury rapid_adaptation
6:19.160 chaos_strike Fluffy_Pillow 75.0/100: 75% fury rapid_adaptation
6:20.541 fel_rush Fluffy_Pillow 35.0/100: 35% fury raid_movement, rapid_adaptation
6:20.971 auto_attack Fluffy_Pillow 60.0/100: 60% fury momentum, rapid_adaptation
6:20.971 throw_glaive Fluffy_Pillow 60.0/100: 60% fury momentum, rapid_adaptation
6:22.352 fel_barrage Fluffy_Pillow 60.0/100: 60% fury momentum, rapid_adaptation
6:23.879 chaos_strike Fluffy_Pillow 60.0/100: 60% fury momentum
6:25.261 demons_bite Fluffy_Pillow 40.0/100: 40% fury
6:26.641 vengeful_retreat Fluffy_Pillow 65.0/100: 65% fury
6:26.641 throw_glaive Fluffy_Pillow 65.0/100: 65% fury momentum, prepared, vengeful_retreat_movement
6:28.021 chaos_strike Fluffy_Pillow 73.0/100: 73% fury momentum, prepared
6:29.402 chaos_strike Fluffy_Pillow 45.0/100: 45% fury momentum, prepared
6:30.784 fel_rush Fluffy_Pillow 17.0/100: 17% fury prepared
6:31.190 chaos_strike Fluffy_Pillow 46.0/100: 46% fury momentum, prepared

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8803 8478 0
Agility 25777 24071 13894 (8121)
Stamina 32604 32604 20855
Intellect 5328 5003 0
Spirit 2 2 0
Health 1956240 1956240 0
Fury 100 100 0
Crit 38.60% 37.53% 7536
Haste 9.01% 9.01% 2927
Damage / Heal Versatility 6.62% 6.62% 2646
Attack Power 25777 24071 0
Mastery 22.12% 22.12% 4943
Armor 2073 2073 2073
Run Speed 9 0 333

Gear

Source Slot Average Item Level: 858.00
Local Head Raddon's Cascading Eyes
ilevel: 895, stats: { 311 Armor, +2959 Sta, +1973 Agi, +882 Crit, +662 Haste }
Local Neck Blackened Portalstone Necklace
ilevel: 850, stats: { +1094 Sta, +1206 Crit, +629 Haste }, gems: { +150 Crit }, enchant: { +75 Crit }
Local Shoulders Swordsinger's Shoulders
ilevel: 840, stats: { 239 Armor, +886 AgiInt, +1329 Sta, +639 Mastery, +303 Haste }
Local Shirt Ebon Filigreed Doublet
ilevel: 1
Local Chest Dreadhide Chestguard
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +899 Crit, +359 Haste }
Local Waist Dreadhide Girdle
ilevel: 865, stats: { 195 Armor, +1119 AgiInt, +1678 Sta, +606 Crit, +429 Haste }
Local Legs Brinewashed Leather Pants
ilevel: 850, stats: { 288 Armor, +1297 AgiInt, +1945 Sta, +820 Mastery, +484 Vers }
Local Feet Mana-Tanned Sandals
ilevel: 860, stats: { 234 Armor, +1601 Sta, +1068 AgiInt, +704 Mastery, +311 Crit }
Local Wrists Wax-Sealed Leather Bracers
ilevel: 860, stats: { 149 Armor, +1201 Sta, +801 AgiInt, +545 Haste, +218 Crit }
Local Hands Reluctant Partisan Gloves
ilevel: 845, stats: { 202 Armor, +929 AgiInt, +1393 Sta, +481 Mastery, +481 Crit }
Local Finger1 Ring of Deep Sea Pearls
ilevel: 870, stats: { +1319 Sta, +1244 Mastery, +735 Vers }, enchant: { +200 Crit }
Local Finger2 Dingy Suramar Mercantile Signet
ilevel: 860, stats: { +1201 Sta, +1362 Crit, +545 Vers }, enchant: { +200 Crit }
Local Trinket1 Nightborne's Hunting Horn
ilevel: 835, stats: { +1073 Agi, +882 Vers }
Local Trinket2 Vindictive Gladiator's Badge of Conquest
ilevel: 840, stats: { +1123 Agi }
Local Back Gossamer-Spun Greatcloak
ilevel: 865, stats: { 137 Armor, +839 StrAgiInt, +1258 Sta, +455 Mastery, +322 Crit, +333 RunSpeed }, enchant: { +200 Agi }
Local Main Hand Twinblades of the Deceiver
ilevel: 875, weapon: { 4159 - 7725, 2.6 }, stats: { +702 Agi, +1052 Sta, +312 Crit, +300 Mastery }, relics: { +42 ilevels, +40 ilevels, +43 ilevels }
Local Off Hand Twinblades of the Deceiver
ilevel: 875, weapon: { 4159 - 7725, 2.6 }, stats: { +702 Agi, +1052 Sta, +312 Crit, +300 Mastery }
Local Tabard Renowned Guild Tabard
ilevel: 1

Talents

Level
15 Fel Mastery (Havoc Demon Hunter) Chaos Cleave (Havoc Demon Hunter) Blind Fury (Havoc Demon Hunter)
30 Prepared (Havoc Demon Hunter) Demon Blades (Havoc Demon Hunter) Demonic Appetite (Havoc Demon Hunter)
45 Felblade First Blood (Havoc Demon Hunter) Bloodlet (Havoc Demon Hunter)
60 Netherwalk (Havoc Demon Hunter) Desperate Instincts (Havoc Demon Hunter) Soul Rending (Havoc Demon Hunter)
75 Momentum (Havoc Demon Hunter) Fel Eruption (Havoc Demon Hunter) Nemesis (Havoc Demon Hunter)
90 Master of the Glaive (Havoc Demon Hunter) Unleashed Power (Havoc Demon Hunter) Demon Reborn (Havoc Demon Hunter)
100 Chaos Blades (Havoc Demon Hunter) Fel Barrage (Havoc Demon Hunter) Demonic (Havoc Demon Hunter)

Profile

demonhunter="Mortwraith"
origin="https://us.api.battle.net/wow/character/thrall/Mortwraith/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/4/157250820-avatar.jpg"
level=110
race=blood_elf
role=attack
position=back
professions=alchemy=4/herbalism=82
talents=1133112
talent_override=fel_barrage,if=active_enemies>1|raid_event.adds.exists
artifact=3:0:0:0:0:1001:3:1002:3:1003:3:1005:3:1006:3:1010:1:1011:1:1012:1:1013:1:1015:1:1016:1:1330:1
spec=havoc

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war
actions.precombat+=/metamorphosis

# Executed every time the actor is available.
actions=auto_attack
# "Getting ready to use meta" conditions, this is used in a few places.
actions+=/variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
# Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
actions+=/variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
# Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on
# single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
actions+=/variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
actions+=/blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
actions+=/call_action_list,name=cooldown
# Fel Rush in at the start of combat.
actions+=/fel_rush,animation_cancel=1,if=time=0
actions+=/pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
actions+=/consume_magic
# Vengeful Retreat backwards through the target to minimize downtime.
actions+=/vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
# Fel Rush for Momentum and for fury from Fel Mastery.
actions+=/fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
# Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
actions+=/fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
actions+=/eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
actions+=/death_sweep,if=variable.blade_dance
actions+=/blade_dance,if=variable.blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
actions+=/fel_eruption
actions+=/felblade,if=fury.deficit>=30+buff.prepared.up*8
actions+=/annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
actions+=/eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
# If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
actions+=/throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
actions+=/chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
# Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
actions+=/demons_bite
actions+=/throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
actions+=/felblade,if=movement.distance|buff.out_of_range.up
actions+=/fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
actions+=/vengeful_retreat,if=movement.distance>15

actions.cooldown=use_item,slot=trinket2,if=buff.chaos_blades.up|!talent.chaos_blades.enabled
actions.cooldown+=/nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
actions.cooldown+=/nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
actions.cooldown+=/nemesis,sync=metamorphosis,if=!raid_event.adds.exists
actions.cooldown+=/chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
actions.cooldown+=/metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
actions.cooldown+=/potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

head=raddons_cascading_eyes,id=137061,bonus_id=1811
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/1808/1472,gems=150crit,enchant=75crit
shoulders=swordsingers_shoulders,id=134286,bonus_id=1727/1502/1813
back=gossamerspun_greatcloak,id=138221,bonus_id=1807/42/1487/3337,enchant=200agi
chest=dreadhide_chestguard,id=121297,bonus_id=3473/1502/1674
shirt=ebon_filigreed_doublet,id=42360
tabard=renowned_guild_tabard,id=69210
wrists=waxsealed_leather_bracers,id=141429,bonus_id=3466/1472
hands=reluctant_partisan_gloves,id=139940,bonus_id=3474/1507/1674
waist=dreadhide_girdle,id=121299,bonus_id=3432/1527/3337
legs=brinewashed_leather_pants,id=134238,bonus_id=3397/1512/3337
feet=manatanned_sandals,id=141430,bonus_id=1472
finger1=ring_of_deep_sea_pearls,id=141545,bonus_id=1482/3336,enchant=200crit
finger2=dingy_suramar_mercantile_signet,id=141492,bonus_id=1472,enchant=200crit
trinket1=nightbornes_hunting_horn,id=134291,bonus_id=3432/607/1497/1674
trinket2=vindictive_gladiators_badge_of_conquest,id=135804,bonus_id=3428/1472
main_hand=twinblades_of_the_deceiver,id=127829,bonus_id=719,gem_id=141255/136719/143687/0,relic_id=3474:1507:1674/1727:1492:1813/3473:1512:3336/0
off_hand=twinblades_of_the_deceiver,id=127830

# Gear Summary
# gear_ilvl=857.81
# gear_agility=13894
# gear_stamina=20855
# gear_crit_rating=7536
# gear_haste_rating=2927
# gear_mastery_rating=4943
# gear_versatility_rating=2646
# gear_speed_rating=333
# gear_armor=2073

Táunks

Táunks : 498266 dps, 221953 dps to main target

  • Race: Blood Elf
  • Class: Demonhunter
  • Spec: Havoc
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
498266.1 498266.1 769.2 / 0.154% 145547.3 / 29.2% 37934.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.0 13.0 Fury 30.87% 47.5 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Táunks/advanced
Talents
  • 15: Fel Mastery (Havoc Demon Hunter)
  • 30: Demon Blades (Havoc Demon Hunter)
  • 45: Bloodlet (Havoc Demon Hunter)
  • 60: Soul Rending (Havoc Demon Hunter)
  • 75: Momentum (Havoc Demon Hunter)
  • 90: Master of the Glaive (Havoc Demon Hunter)
  • 100: Fel Barrage (Havoc Demon Hunter)
  • Talent Calculator
Artifact
Professions
  • skinning: 800
Scale Factors for Táunks Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 17.43 12.08 10.91 8.20 7.80
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.98 0.97 0.97 0.97 0.97
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste ~= Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=17.43, CritRating=10.91, HasteRating=8.20, MasteryRating=7.80, Versatility=12.08 )

Scale Factors for other metrics

Scale Factors for Táunks Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 17.43 12.08 10.91 8.20 7.80
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.98 0.97 0.97 0.97 0.97
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste ~= Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=17.43, CritRating=10.91, HasteRating=8.20, MasteryRating=7.80, Versatility=12.08 )
Scale Factors for Táunks Priority Target Damage Per Second
Agi Crit Vers Haste Mastery
Scale Factors 7.12 5.75 5.47 4.52 3.43
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.20 0.20 0.20 0.20 0.20
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Vers > Haste > Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=7.12, CritRating=5.75, HasteRating=4.52, MasteryRating=3.43, Versatility=5.47 )
Scale Factors for Táunks Damage Per Second (Effective)
Agi Vers Crit Haste Mastery
Scale Factors 17.43 12.08 10.91 8.20 7.80
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=17.43, CritRating=10.91, HasteRating=8.20, MasteryRating=7.80, Versatility=12.08 )
Scale Factors for Táunks Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for TáunksTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Táunks 498266
Annihilation 17226 3.4% 19.1 15.88sec 356755 378520 Direct 38.2 115730 259179 178383 43.7% 0.0%  

Stats details: annihilation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.08 38.15 0.00 0.00 0.9425 0.0000 6805418.87 6805418.87 0.00 378520.43 378520.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.49 56.33% 115729.76 93145 139522 115720.72 104706 125648 2486838 2486838 0.00
crit 16.66 43.67% 259179.24 208644 312528 259178.40 0 281451 4318581 4318581 0.00
 
 

Action details: annihilation

Static Values
  • id:201427
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
Spelldata
  • id:201427
  • name:Annihilation
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$227518sw1+$201428sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
auto_attack_mh 8218 1.7% 139.5 2.87sec 23616 11542 Direct 139.5 18932 37867 23616 43.7% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 139.46 139.46 0.00 0.00 2.0460 0.0000 3293362.59 4841554.97 31.98 11542.37 11542.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.93 37.24% 18931.90 17077 20493 18930.22 18185 19781 983094 1445242 31.98
crit 61.01 43.75% 37866.54 34155 40986 37864.42 36269 39378 2310268 3396313 31.98
miss 26.52 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 4109 0.8% 139.5 2.87sec 11806 5773 Direct 139.5 9468 18932 11807 43.7% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 139.47 139.47 0.00 0.00 2.0453 0.0000 1646596.75 2420653.20 31.98 5772.53 5772.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.01 37.29% 9467.75 8539 10246 9467.18 9051 9861 492444 723939 31.98
crit 60.96 43.71% 18931.54 17077 20493 18930.53 18114 19761 1154153 1696714 31.98
miss 26.49 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blade Dance 47934 9.6% 19.1 15.04sec 993387 760518 Direct 435.6 30225 60435 43454 43.8% 0.0%  

Stats details: blade_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.05 435.56 0.00 0.00 1.3062 0.0000 18927002.43 27824486.39 31.98 760517.64 760517.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 244.83 56.21% 30225.44 15884 65511 30228.52 26513 34238 7400095 10878841 31.98
crit 190.73 43.79% 60434.99 31768 131022 60442.54 50899 68781 11526907 16945645 31.98
 
 

Action details: blade_dance

Static Values
  • id:188499
  • school:physical
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_dance
Spelldata
  • id:188499
  • name:Blade Dance
  • school:physical
  • tooltip:Dodge chance increased by {$s2=100}%.
  • description:Strike all nearby enemies for ${$sw2+2*$199552sw2+$200685sw2} Physical damage, and increase your chance to dodge by {$s2=100}% for {$d=1 second}.
 
Chaos Strike 55400 11.3% 81.2 4.49sec 275645 208255 Direct 162.3 89444 200367 137913 43.7% 0.0%  

Stats details: chaos_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.19 162.27 0.00 0.00 1.3236 0.0000 22379511.58 22379511.58 0.00 208255.12 208255.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 91.37 56.31% 89444.03 71650 107475 89401.07 84956 93726 8172441 8172441 0.00
crit 70.91 43.69% 200366.88 160495 240743 200275.99 187502 212227 14207071 14207071 0.00
 
 

Action details: chaos_strike

Static Values
  • id:162794
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
Spelldata
  • id:162794
  • name:Chaos Strike
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$222031sw1+$199547sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
Death Sweep 17660 3.5% 4.8 64.98sec 1440793 1456530 Direct 108.9 44549 89121 64048 43.7% 0.0%  

Stats details: death_sweep

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.84 108.86 0.00 0.00 0.9893 0.0000 6972408.80 10250101.39 31.98 1456529.94 1456529.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.24 56.25% 44549.14 23661 97584 44634.27 33819 58208 2728159 4010652 31.98
crit 47.62 43.75% 89121.12 47322 195168 89273.74 64682 125107 4244250 6239450 31.98
 
 

Action details: death_sweep

Static Values
  • id:210152
  • school:physical
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_dance
Spelldata
  • id:210152
  • name:Death Sweep
  • school:physical
  • tooltip:Dodge chance increased by {$s3=0}%.
  • description:Strike all nearby enemies for ${3*$210153sw2+$210155sw2} Physical damage, and increase your Dodge chance by {$s2=100}% for {$d=1 second}.
 
Demon Blades 15596 3.2% 166.8 5.99sec 37461 0 Direct 166.8 26067 52138 37460 43.7% 0.0%  

Stats details: demon_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 166.84 166.84 0.00 0.00 0.0000 0.0000 6250108.81 6250108.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.93 56.30% 26066.85 23687 28424 26067.80 24933 27290 2448443 2448443 0.00
crit 72.92 43.70% 52137.94 47373 56848 52139.53 49694 54953 3801666 3801666 0.00
 
 

Action details: demon_blades

Static Values
  • id:203796
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203796
  • name:Demon Blades
  • school:shadow
  • tooltip:
  • description:Inflicts $sw1 Shadow damage and generates $m3 to $M3 Fury.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.85
 
Eye Beam 36828 (52139) 7.4% (10.4%) 7.4 54.11sec 2782751 1486478 Periodic 321.8 0 45360 45360 100.0% 0.0% 3.0%

Stats details: eye_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.43 0.00 71.66 321.80 1.8720 0.1652 14596807.43 14596807.43 0.00 1486477.59 1486477.59
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 321.8 100.00% 45360.00 40576 48691 45353.54 40605 48691 14596807 14596807 0.00
 
 

Action details: eye_beam

Static Values
  • id:198013
  • school:chaos
  • resource:fury
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
Spelldata
  • id:198013
  • name:Eye Beam
  • school:chromatic
  • tooltip:
  • description:Blasts all enemies directly in front of you for $<dmg> Chaos damage. Eye Beam always critically strikes.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Anguish 15312 3.1% 0.0 0.00sec 0 0 Direct 31.5 133960 267845 192674 43.9% 0.0%  

Stats details: anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 31.50 0.00 0.00 0.0000 0.0000 6069690.47 6069690.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.69 56.15% 133959.50 12503 150039 133965.97 71518 150039 2369326 2369326 0.00
crit 13.82 43.85% 267845.15 25006 300077 267863.33 150039 300077 3700364 3700364 0.00
 
 

Action details: anguish

Static Values
  • id:202446
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202446
  • name:Anguish
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals {$202446s1=10} Chaos damage to the victim per application.}
 
Fel Barrage 41843 8.3% 9.3 44.93sec 1767649 1177379 Direct 144.7 79354 158653 114131 43.9% 0.0%  

Stats details: fel_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.35 144.74 45.25 0.00 1.5014 0.1984 16519800.34 16519800.34 0.00 1177378.69 1177378.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.27 56.14% 79354.00 62516 93774 79367.48 0 93774 6448806 6448806 0.00
crit 63.48 43.86% 158653.17 125032 187548 158680.60 0 187548 10070995 10070995 0.00
 
 

Action details: fel_barrage

Static Values
  • id:211053
  • school:chaos
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Spelldata
  • id:211053
  • name:Fel Barrage
  • school:magic
  • tooltip:Unleashing Fel.
  • description:At your command, unleash Fel, inflicting ${{$211052s1=0}} Chaos damage to your target and nearby enemies for each charge. Max 5 charges. Your damaging abilities have a chance to generate a charge.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Fel Rush 70270 14.1% 42.5 9.52sec 656152 1624046 Direct 161.2 120239 240496 172831 43.7% 0.0%  

Stats details: fel_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.46 161.21 0.00 0.00 0.4040 0.0000 27862133.42 27862133.42 0.00 1624046.01 1624046.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.71 56.27% 120239.38 119468 143362 120240.73 119468 124019 10906603 10906603 0.00
crit 70.50 43.73% 240496.40 238936 286724 240495.65 238936 249229 16955531 16955531 0.00
 
 

Action details: fel_rush

Static Values
  • id:195072
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.2500
  • min_gcd:0.2500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time=0
Spelldata
  • id:195072
  • name:Fel Rush
  • school:physical
  • tooltip:
  • description:Rush forward, incinerating anything in your path for {$192611s1=0} Chaos damage.$?a192939[ |cFFFFFFFFGenerates {$192939s1=25} Fury if you damage an enemy.|r][]
 
Fury of the Illidari 43260 8.7% 7.1 60.41sec 2418548 1934213 Periodic 448.1 26594 53203 38235 43.7% 0.0% 5.3%

Stats details: fury_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.08 0.00 49.42 448.06 1.2505 0.4283 17131323.70 17131323.70 0.00 570549.65 1934212.91
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 252.1 56.25% 26594.18 15859 38062 26594.97 24331 29100 6703135 6703135 0.00
crit 196.0 43.75% 53203.28 31718 76124 53205.60 47206 59773 10428189 10428189 0.00
 
 

Action details: fury_of_the_illidari

Static Values
  • id:201467
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:3.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
Spelldata
  • id:201467
  • name:Fury of the Illidari
  • school:physical
  • tooltip:
  • description:Throws the |cFFFFCC99Twinblades of the Deceiver|r in a whirlwind of energy, causing ${7*($201628sw1+$201789sw1)} Chaos damage over {$d=3 seconds} to all nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Inner Demons 15028 3.0% 7.0 53.23sec 857305 0 Direct 18.1 229125 458014 329554 43.9% 0.0%  

Stats details: inner_demons

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.97 18.12 0.00 0.00 0.0000 0.0000 5971385.33 5971385.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.17 56.12% 229125.03 203177 243813 228528.79 0 243813 2329745 2329745 0.00
crit 7.95 43.88% 458013.95 406354 487625 455362.60 0 487625 3641641 3641641 0.00
 
 

Action details: inner_demons

Static Values
  • id:202388
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202388
  • name:Inner Demons
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201471=Chaos Strike has a chance to unleash your inner demon, causing it to crash into your target and deal {$202388s1=0} Chaos damage to all nearby enemies.}
 
Metamorphosis (_impact) 1593 0.3% 2.0 243.85sec 314047 0 Direct 6.4 68321 136547 98219 43.8% 0.0%  

Stats details: metamorphosis_impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 6.41 0.00 0.00 0.0000 0.0000 629161.99 629161.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.60 56.18% 68320.97 62516 75019 66271.34 0 75019 245858 245858 0.00
crit 2.81 43.82% 136547.23 125032 150039 129165.94 0 150039 383304 383304 0.00
 
 

Action details: metamorphosis_impact

Static Values
  • id:200166
  • school:chaos
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:200166
  • name:Metamorphosis
  • school:chromatic
  • tooltip:Stunned.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
 
Potion of the Old War 11100 2.2% 22.9 12.91sec 191666 0 Direct 22.9 133325 266635 191667 43.8% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.87 22.87 0.00 0.00 0.0000 0.0000 4383169.11 6443673.77 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.86 56.24% 133325.04 118093 141712 133292.96 122817 141712 1714631 2520670 31.98
crit 10.01 43.76% 266634.83 236186 283423 266565.20 236186 283423 2668538 3923004 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Throw Glaive 42002 (93640) 8.4% (18.8%) 49.6 8.10sec 749992 608029 Direct 112.9 102785 205648 147837 43.8% 0.0%  

Stats details: throw_glaive

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.63 112.86 0.00 0.00 1.2335 0.0000 16684838.19 24528292.57 31.98 608029.42 608029.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.43 56.20% 102785.30 90521 108626 102780.33 96987 107438 6519655 9584511 31.98
crit 49.43 43.80% 205647.95 181043 217251 205633.38 194041 215312 10165183 14943782 31.98
 
 

Action details: throw_glaive

Static Values
  • id:185123
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
Spelldata
  • id:185123
  • name:Throw Glaive
  • school:physical
  • tooltip:
  • description:Throw a demonic glaive at the target, dealing $sw1 Physical damage. The glaive can ricochet to ${$x1-1} additional enemies within 10 yards.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.90
 
    Bloodlet 51638 10.4% 0.0 0.00sec 0 0 Periodic 359.5 57133 0 57133 0.0% 0.0% 179.5%

Stats details: bloodlet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 359.50 359.50 0.0000 2.0000 20539331.18 20539331.18 0.00 28566.45 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 359.5 100.00% 57133.20 27156 141691 57148.57 48100 67187 20539331 20539331 0.00
 
 

Action details: bloodlet

Static Values
  • id:207690
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207690
  • name:Bloodlet
  • school:physical
  • tooltip:Inflicts $w1 damage every $t1 sec.
  • description:{$@spelldesc206473=Throw Glaive causes targets to bleed for {$s1=150}% of the damage inflicted over {$207690d=10 seconds}. If this effect is reapplied, any remaining damage will be added to the new Bloodlet.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vengeful Retreat 3250 0.7% 15.9 25.82sec 81203 0 Direct 55.8 16064 32128 23081 43.7% 0.0%  

Stats details: vengeful_retreat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.87 55.83 0.00 0.00 0.0000 0.0000 1288555.56 1894298.73 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.44 56.32% 16064.13 16064 16064 16064.13 16064 16064 505065 742493 31.98
crit 24.39 43.68% 32128.26 32128 32128 32128.26 32128 32128 783491 1151805 31.98
 
 

Action details: vengeful_retreat

Static Values
  • id:198793
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Spelldata
  • id:198793
  • name:Vengeful Retreat
  • school:physical
  • tooltip:
  • description:Remove all snares and vault away. Nearby enemies take $198813sw2 Physical damage and have their movement speed reduced by {$198813s1=70}% for {$198813d=3 seconds}.$?a203551[ |cFFFFFFFFGenerates $203650o1 Fury over {$203650d=5 seconds} if you damage an enemy.|r][]
 
Simple Action Stats Execute Interval
Táunks
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Táunks
  • harmful:false
  • if_expr:
 
Blur 3.4 107.08sec

Stats details: blur

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.44 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blur

Static Values
  • id:198589
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
Spelldata
  • id:198589
  • name:Blur
  • school:physical
  • tooltip:
  • description:Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.
 
Consume Magic 13.2 30.92sec

Stats details: consume_magic

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.22 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: consume_magic

Static Values
  • id:183752
  • school:chromatic
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:183752
  • name:Consume Magic
  • school:chromatic
  • tooltip:
  • description:Interrupts the enemy's spellcasting and locks them from that school of magic for {$d=3 seconds}.|cFFFFFFFF{$?s178940=false}[ Generates {$218903s1=50} Fury on a successful interrupt.][ Generates ${{$218903s2=500}/10} Pain on a successful interrupt.]|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Táunks
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Táunks
  • harmful:false
  • if_expr:
 
Metamorphosis 1.0 243.85sec

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.1762 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: metamorphosis

Static Values
  • id:191427
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:240.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191427
  • name:Metamorphosis
  • school:physical
  • tooltip:
  • description:Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blade Dance 19.1 0.0 15.0sec 15.0sec 4.83% 4.83% 0.0(0.0) 19.1

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_blade_dance
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • blade_dance_1:4.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188499
  • name:Blade Dance
  • tooltip:Dodge chance increased by {$s2=100}%.
  • description:Strike all nearby enemies for ${$sw2+2*$199552sw2+$200685sw2} Physical damage, and increase your chance to dodge by {$s2=100}% for {$d=1 second}.
  • max_stacks:0
  • duration:1.00
  • cooldown:10.00
  • default_chance:0.00%
Blood Frenzy 14.2 8.7 28.3sec 17.3sec 45.57% 45.57% 8.7(8.7) 13.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2743.21

Stack Uptimes

  • blood_frenzy_1:45.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 12.62% 0.0(0.0) 1.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blur 3.4 0.0 106.5sec 106.5sec 8.41% 8.41% 0.0(0.0) 3.3

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_blur
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.35

Stack Uptimes

  • blur_1:8.41%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:212800
  • name:Blur
  • tooltip:Dodge increased by {$s2=50}%. All damage reduced by {$s3=35}%.
  • description:{$@spelldesc198589=Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
Death Sweep 4.8 0.0 65.1sec 65.1sec 1.23% 1.23% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_death_sweep
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • death_sweep_1:1.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210152
  • name:Death Sweep
  • tooltip:Dodge chance increased by {$s3=0}%.
  • description:Strike all nearby enemies for ${3*$210153sw2+$210155sw2} Physical damage, and increase your Dodge chance by {$s2=100}% for {$d=1 second}.
  • max_stacks:0
  • duration:1.00
  • cooldown:8.00
  • default_chance:0.00%
fel_rush_movement 1.6 0.0 123.9sec 123.9sec 0.10% 0.10% 0.0(0.0) 1.6

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_fel_rush_movement
  • max_stacks:1
  • duration:0.25
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fel_rush_movement_1:0.10%

Trigger Attempt Success

  • trigger_pct:90.04%
Metamorphosis 8.1 0.3 53.4sec 49.3sec 18.24% 19.55% 0.3(0.3) 8.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • metamorphosis_1:18.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162264
  • name:Metamorphosis
  • tooltip:Chaos Strike and Blade Dance upgraded to $@spellname201427 and $@spellname210152. Haste increased by {$s7=25}%.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Momentum 57.5 0.9 7.0sec 7.0sec 57.49% 62.68% 0.9(0.9) 56.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_momentum
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • momentum_1:57.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208628
  • name:Momentum
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Increases all damage done by {$s1=20}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
out_of_range 16.5 16.5 24.7sec 12.0sec 1.47% 1.47% 16.5(16.5) 0.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_out_of_range
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • out_of_range_1:1.47%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of the Old War 2.0 0.0 248.2sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 1.9 12.0sec 11.3sec 10.68% 10.68% 1.9(1.9) 0.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:10.68%

Trigger Attempt Success

  • trigger_pct:100.00%
vengeful_retreat_movement 15.9 0.0 25.8sec 25.8sec 3.96% 3.96% 0.0(0.0) 15.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_vengeful_retreat_movement
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vengeful_retreat_movement_1:3.96%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Táunks
annihilation Fury 19.1 763.1 40.0 40.0 8918.6
blade_dance Fury 19.1 666.9 35.0 35.0 28382.1
chaos_strike Fury 81.2 3247.6 40.0 40.0 6891.1
death_sweep Fury 4.8 169.4 35.0 35.0 41166.7
eye_beam Fury 7.4 371.3 50.0 50.0 55654.8
Resource Gains Type Count Total Average Overflow
demon_blades Fury 166.85 2662.01 (50.70%) 15.95 7.09 0.27%
fel_rush_dmg Fury 42.46 1061.44 (20.22%) 25.00 0.13 0.01%
consume_magic Fury 13.22 651.92 (12.42%) 49.30 9.24 1.40%
annihilation Fury 8.33 166.62 (3.17%) 20.00 0.00 0.00%
chaos_strike Fury 35.43 708.61 (13.50%) 20.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Fury 13.11 13.03
Combat End Resource Mean Min Max
Fury 32.03 0.00 130.00

Benefits & Uptimes

Benefits %
Uptimes %
Fury Cap 0.2%

Procs

Count Interval
delayed_swing__out_of_range 4.1 107.1sec
delayed_swing__channeling 13.4 59.8sec
demon_blades_wasted 0.5 16.3sec
fel_barrage 25.9 15.0sec

Statistics & Data Analysis

Fight Length
Sample Data Táunks Fight Length
Count 9999
Mean 400.62
Minimum 307.54
Maximum 499.01
Spread ( max - min ) 191.47
Range [ ( max - min ) / 2 * 100% ] 23.90%
DPS
Sample Data Táunks Damage Per Second
Count 9999
Mean 498266.13
Minimum 403020.39
Maximum 638717.10
Spread ( max - min ) 235696.71
Range [ ( max - min ) / 2 * 100% ] 23.65%
Standard Deviation 39241.3243
5th Percentile 441301.65
95th Percentile 566527.41
( 95th Percentile - 5th Percentile ) 125225.75
Mean Distribution
Standard Deviation 392.4329
95.00% Confidence Intervall ( 497496.97 - 499035.28 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 238
0.1% Error 23826
0.1 Scale Factor Error with Delta=300 13145314
0.05 Scale Factor Error with Delta=300 52581257
0.01 Scale Factor Error with Delta=300 1314531443
Priority Target DPS
Sample Data Táunks Priority Target Damage Per Second
Count 9999
Mean 221953.44
Minimum 193477.55
Maximum 253730.92
Spread ( max - min ) 60253.36
Range [ ( max - min ) / 2 * 100% ] 13.57%
Standard Deviation 8154.2863
5th Percentile 208790.54
95th Percentile 235742.07
( 95th Percentile - 5th Percentile ) 26951.53
Mean Distribution
Standard Deviation 81.5469
95.00% Confidence Intervall ( 221793.61 - 222113.27 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5184
0.1 Scale Factor Error with Delta=300 567617
0.05 Scale Factor Error with Delta=300 2270468
0.01 Scale Factor Error with Delta=300 56761723
DPS(e)
Sample Data Táunks Damage Per Second (Effective)
Count 9999
Mean 498266.13
Minimum 403020.39
Maximum 638717.10
Spread ( max - min ) 235696.71
Range [ ( max - min ) / 2 * 100% ] 23.65%
Damage
Sample Data Táunks Damage
Count 9999
Mean 197950606.55
Minimum 163757184.49
Maximum 233449464.44
Spread ( max - min ) 69692279.95
Range [ ( max - min ) / 2 * 100% ] 17.60%
DTPS
Sample Data Táunks Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Táunks Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Táunks Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Táunks Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Táunks Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Táunks Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data TáunksTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Táunks Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
5 0.00 metamorphosis
Default action list Executed every time the actor is available.
# count action,conditions
6 41.85 auto_attack
0.00 variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
"Getting ready to use meta" conditions, this is used in a few places.
0.00 variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
0.00 variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on # single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
7 3.44 blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
8 0.00 call_action_list,name=cooldown
9 1.00 fel_rush,animation_cancel=1,if=time=0
Fel Rush in at the start of combat.
0.00 pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
A 13.22 consume_magic
B 15.98 vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Vengeful Retreat backwards through the target to minimize downtime.
C 39.89 fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
Fel Rush for Momentum and for fury from Fel Mastery.
D 3.43 fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
E 2.23 throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
F 7.11 fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
0.00 eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
G 4.86 death_sweep,if=variable.blade_dance
H 19.12 blade_dance,if=variable.blade_dance
I 20.30 throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
0.00 fel_eruption
0.00 felblade,if=fury.deficit>=30+buff.prepared.up*8
J 19.08 annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
K 10.91 throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
L 7.44 eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
M 9.28 throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
N 81.19 chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
O 5.92 fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
0.00 fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
0.00 demons_bite
P 7.05 throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
0.00 felblade,if=movement.distance|buff.out_of_range.up
Q 1.58 fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
0.00 vengeful_retreat,if=movement.distance>15
actions.cooldown
# count action,conditions
0.00 nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
0.00 nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
0.00 nemesis,sync=metamorphosis,if=!raid_event.adds.exists
0.00 chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
R 1.00 metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
S 1.00 potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

Sample Sequence

0124569D6EAFJKBJJKJJCJP6JJJJJCII6GP6BHICL6O6MHANNNC6NNNM6HBINCN6HFCINNNNP6ANNBQI6HLNCD6HIC7NNNCNNNBPPQ6HANMNHCNF6CNIHB6NNNC6HICILHANNMB6DHNCNNNNMM6CHCNIBHFNCD6AINNNNNNM6HC6IALBNHCIN6NNCNANNMM6HBD6CIHFARSJCJJP6JJJBI6GAJCJIGC76LCDGIHNCP6NBNANI6HCI6HFCINONNBNK6CLCNKNNNANCK6NNNBNKNNC6KC7NNCNKLB6FO6KCNNANNNCK6CNKNNBNN

Sample Sequence Table

time name target resources buffs
Pre flask Táunks 0.0/130: 0% fury
Pre food Táunks 0.0/130: 0% fury
Pre augmentation Táunks 0.0/130: 0% fury
Pre potion Fluffy_Pillow 0.0/130: 0% fury potion_of_the_old_war
0:00.000 metamorphosis Fluffy_Pillow 0.0/130: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/130: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 fel_rush Fluffy_Pillow 0.0/130: 0% fury metamorphosis, blood_frenzy, potion_of_the_old_war
0:00.393 fel_barrage Fluffy_Pillow 25.0/130: 19% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:01.630 auto_attack Fluffy_Pillow 25.0/130: 19% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:01.630 throw_glaive Fluffy_Pillow 25.0/130: 19% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:02.419 consume_magic Fluffy_Pillow 25.0/130: 19% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:02.419 fury_of_the_illidari Fluffy_Pillow 75.0/130: 58% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:03.205 annihilation Fluffy_Pillow 75.0/130: 58% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:03.993 throw_glaive Fluffy_Pillow 35.0/130: 27% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:04.782 vengeful_retreat Fluffy_Pillow 35.0/130: 27% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:04.782 Waiting 0.100 sec 35.0/130: 27% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement, blood_frenzy, potion_of_the_old_war
0:04.882 annihilation Fluffy_Pillow 68.0/130: 52% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement, blood_frenzy, potion_of_the_old_war
0:05.669 annihilation Fluffy_Pillow 48.0/130: 37% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement, blood_frenzy, potion_of_the_old_war
0:06.458 Waiting 0.200 sec 28.0/130: 22% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:06.658 throw_glaive Fluffy_Pillow 28.0/130: 22% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:07.647 Waiting 1.300 sec 28.0/130: 22% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:08.947 annihilation Fluffy_Pillow 84.0/130: 65% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:09.736 annihilation Fluffy_Pillow 64.0/130: 49% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:10.524 fel_rush Fluffy_Pillow 24.0/130: 18% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:10.979 annihilation Fluffy_Pillow 49.0/130: 38% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:11.769 Waiting 0.300 sec 29.0/130: 22% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:12.069 throw_glaive Fluffy_Pillow 29.0/130: 22% fury bloodlust, raid_movement, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:12.878 Waiting 0.100 sec 29.0/130: 22% fury bloodlust, raid_movement, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:12.978 auto_attack Fluffy_Pillow 29.0/130: 22% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:12.978 Waiting 1.400 sec 29.0/130: 22% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:14.378 annihilation Fluffy_Pillow 89.0/130: 68% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:15.167 annihilation Fluffy_Pillow 49.0/130: 38% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:15.956 Waiting 1.200 sec 29.0/130: 22% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:17.156 annihilation Fluffy_Pillow 96.0/130: 74% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:17.944 annihilation Fluffy_Pillow 56.0/130: 43% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:18.733 Waiting 1.200 sec 16.0/130: 12% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:19.933 annihilation Fluffy_Pillow 48.0/130: 37% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:20.720 fel_rush Fluffy_Pillow 8.0/130: 6% fury bloodlust, raid_movement, metamorphosis, blood_frenzy, potion_of_the_old_war
0:21.145 throw_glaive Fluffy_Pillow 33.0/130: 25% fury bloodlust, raid_movement, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:21.934 Waiting 0.500 sec 33.0/130: 25% fury bloodlust, raid_movement, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:22.434 throw_glaive Fluffy_Pillow 33.0/130: 25% fury bloodlust, raid_movement, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:23.400 auto_attack Fluffy_Pillow 33.0/130: 25% fury bloodlust, metamorphosis, momentum, blood_frenzy
0:23.400 Waiting 2.800 sec 33.0/130: 25% fury bloodlust, metamorphosis, momentum, blood_frenzy
0:26.200 death_sweep Fluffy_Pillow 52.0/130: 40% fury bloodlust, metamorphosis, blood_frenzy
0:26.987 Waiting 1.100 sec 17.0/130: 13% fury bloodlust, metamorphosis, death_sweep, blood_frenzy
0:28.087 throw_glaive Fluffy_Pillow 31.0/130: 24% fury bloodlust, raid_movement, metamorphosis, blood_frenzy
0:28.875 Waiting 0.100 sec 31.0/130: 24% fury bloodlust, raid_movement, metamorphosis, blood_frenzy
0:28.975 auto_attack Fluffy_Pillow 31.0/130: 24% fury bloodlust, metamorphosis, blood_frenzy
0:28.975 Waiting 0.600 sec 31.0/130: 24% fury bloodlust, metamorphosis, blood_frenzy
0:29.575 vengeful_retreat Fluffy_Pillow 31.0/130: 24% fury bloodlust, metamorphosis, blood_frenzy
0:29.782 Waiting 0.600 sec 31.0/130: 24% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement, blood_frenzy
0:30.382 blade_dance Fluffy_Pillow 45.0/130: 35% fury bloodlust, momentum, vengeful_retreat_movement, blood_frenzy
0:31.368 Waiting 1.500 sec 10.0/130: 8% fury bloodlust, blade_dance, momentum, blood_frenzy
0:32.868 throw_glaive Fluffy_Pillow 26.0/130: 20% fury bloodlust, momentum, blood_frenzy
0:34.052 fel_rush Fluffy_Pillow 26.0/130: 20% fury bloodlust, blood_frenzy
0:34.477 eye_beam Fluffy_Pillow 51.0/130: 39% fury bloodlust, momentum, blood_frenzy
0:36.139 auto_attack Fluffy_Pillow 1.0/130: 1% fury bloodlust, metamorphosis, momentum
0:36.139 Waiting 0.400 sec 1.0/130: 1% fury bloodlust, metamorphosis, momentum
0:36.539 fel_barrage Fluffy_Pillow 1.0/130: 1% fury bloodlust, momentum
0:37.838 auto_attack Fluffy_Pillow 1.0/130: 1% fury bloodlust, momentum
0:37.838 Waiting 0.500 sec 1.0/130: 1% fury bloodlust, momentum
0:38.338 throw_glaive Fluffy_Pillow 1.0/130: 1% fury bloodlust
0:39.632 blade_dance Fluffy_Pillow 69.0/130: 53% fury bloodlust
0:40.692 consume_magic Fluffy_Pillow 34.0/130: 26% fury bloodlust
0:40.692 chaos_strike Fluffy_Pillow 84.0/130: 65% fury bloodlust
0:41.754 chaos_strike Fluffy_Pillow 64.0/130: 49% fury
0:43.131 chaos_strike Fluffy_Pillow 44.0/130: 34% fury
0:44.509 fel_rush Fluffy_Pillow 24.0/130: 18% fury raid_movement
0:44.874 Waiting 0.100 sec 49.0/130: 38% fury raid_movement, momentum
0:44.974 auto_attack Fluffy_Pillow 49.0/130: 38% fury momentum
0:44.974 chaos_strike Fluffy_Pillow 49.0/130: 38% fury momentum
0:46.352 Waiting 1.100 sec 29.0/130: 22% fury momentum
0:47.452 chaos_strike Fluffy_Pillow 54.0/130: 42% fury momentum
0:48.830 Waiting 1.000 sec 34.0/130: 26% fury
0:49.830 chaos_strike Fluffy_Pillow 101.0/130: 78% fury
0:51.208 throw_glaive Fluffy_Pillow 61.0/130: 47% fury raid_movement
0:52.586 Waiting 0.400 sec 61.0/130: 47% fury raid_movement
0:52.986 auto_attack Fluffy_Pillow 61.0/130: 47% fury
0:52.986 blade_dance Fluffy_Pillow 61.0/130: 47% fury
0:54.364 Waiting 0.200 sec 26.0/130: 20% fury
0:54.564 vengeful_retreat Fluffy_Pillow 26.0/130: 20% fury
0:54.782 Waiting 1.200 sec 26.0/130: 20% fury momentum, vengeful_retreat_movement
0:55.982 throw_glaive Fluffy_Pillow 66.0/130: 51% fury momentum, out_of_range
0:57.528 Waiting 0.300 sec 66.0/130: 51% fury momentum
0:57.828 chaos_strike Fluffy_Pillow 83.0/130: 64% fury momentum, blood_frenzy
0:59.106 fel_rush Fluffy_Pillow 63.0/130: 48% fury blood_frenzy
0:59.488 chaos_strike Fluffy_Pillow 88.0/130: 68% fury momentum, blood_frenzy
1:00.766 Waiting 0.200 sec 48.0/130: 37% fury raid_movement, momentum, blood_frenzy
1:00.966 auto_attack Fluffy_Pillow 48.0/130: 37% fury momentum, blood_frenzy
1:00.966 Waiting 0.700 sec 48.0/130: 37% fury momentum, blood_frenzy
1:01.666 blade_dance Fluffy_Pillow 48.0/130: 37% fury momentum, blood_frenzy
1:03.104 fury_of_the_illidari Fluffy_Pillow 13.0/130: 10% fury momentum, blood_frenzy
1:04.382 fel_rush Fluffy_Pillow 13.0/130: 10% fury blood_frenzy
1:04.782 throw_glaive Fluffy_Pillow 38.0/130: 29% fury momentum, blood_frenzy
1:06.060 Waiting 4.000 sec 38.0/130: 29% fury momentum, blood_frenzy
1:10.060 chaos_strike Fluffy_Pillow 130.0/130: 100% fury
1:11.436 chaos_strike Fluffy_Pillow 110.0/130: 85% fury
1:12.812 chaos_strike Fluffy_Pillow 90.0/130: 69% fury
1:14.188 chaos_strike Fluffy_Pillow 50.0/130: 38% fury blood_frenzy
1:15.466 Waiting 0.600 sec 30.0/130: 23% fury blood_frenzy
1:16.066 throw_glaive Fluffy_Pillow 30.0/130: 23% fury raid_movement, blood_frenzy
1:17.344 auto_attack Fluffy_Pillow 30.0/130: 23% fury blood_frenzy
1:17.344 consume_magic Fluffy_Pillow 30.0/130: 23% fury blood_frenzy
1:17.344 chaos_strike Fluffy_Pillow 80.0/130: 62% fury blood_frenzy
1:18.621 chaos_strike Fluffy_Pillow 60.0/130: 46% fury blood_frenzy
1:19.899 vengeful_retreat Fluffy_Pillow 20.0/130: 15% fury blood_frenzy
1:19.899 Waiting 1.300 sec 20.0/130: 15% fury momentum, vengeful_retreat_movement, blood_frenzy
1:21.199 fel_rush Fluffy_Pillow 20.0/130: 15% fury raid_movement, momentum, blood_frenzy
1:21.586 Waiting 0.300 sec 45.0/130: 35% fury momentum, out_of_range, blood_frenzy
1:21.886 throw_glaive Fluffy_Pillow 45.0/130: 35% fury momentum, out_of_range, blood_frenzy
1:23.402 auto_attack Fluffy_Pillow 45.0/130: 35% fury momentum
1:23.402 blade_dance Fluffy_Pillow 45.0/130: 35% fury momentum
1:24.781 Waiting 1.100 sec 10.0/130: 8% fury momentum
1:25.881 eye_beam Fluffy_Pillow 75.0/130: 58% fury
1:28.021 Waiting 2.600 sec 25.0/130: 19% fury
1:30.621 chaos_strike Fluffy_Pillow 104.0/130: 80% fury
1:31.998 fel_rush Fluffy_Pillow 84.0/130: 65% fury
1:32.400 fel_barrage Fluffy_Pillow 109.0/130: 84% fury raid_movement, momentum
1:33.969 auto_attack Fluffy_Pillow 109.0/130: 84% fury momentum
1:33.969 blade_dance Fluffy_Pillow 109.0/130: 84% fury momentum
1:35.348 throw_glaive Fluffy_Pillow 74.0/130: 57% fury momentum, blood_frenzy
1:36.627 fel_rush Fluffy_Pillow 74.0/130: 57% fury blood_frenzy
1:36.949 blur Fluffy_Pillow 99.0/130: 76% fury momentum, blood_frenzy
1:36.949 chaos_strike Fluffy_Pillow 99.0/130: 76% fury blur, momentum, blood_frenzy
1:38.226 chaos_strike Fluffy_Pillow 79.0/130: 61% fury blur, momentum, blood_frenzy
1:39.507 Waiting 1.100 sec 39.0/130: 30% fury blur, momentum, blood_frenzy
1:40.607 chaos_strike Fluffy_Pillow 92.0/130: 71% fury blur, momentum, blood_frenzy
1:41.886 fel_rush Fluffy_Pillow 52.0/130: 40% fury blur, blood_frenzy
1:42.325 chaos_strike Fluffy_Pillow 77.0/130: 59% fury blur, momentum, blood_frenzy
1:43.601 chaos_strike Fluffy_Pillow 57.0/130: 44% fury blur, momentum, blood_frenzy
1:44.881 Waiting 0.200 sec 17.0/130: 13% fury blur, momentum, blood_frenzy
1:45.081 chaos_strike Fluffy_Pillow 42.0/130: 32% fury blur, momentum, blood_frenzy
1:46.361 vengeful_retreat Fluffy_Pillow 22.0/130: 17% fury blur, blood_frenzy
1:46.361 Waiting 0.900 sec 22.0/130: 17% fury blur, momentum, vengeful_retreat_movement, blood_frenzy
1:47.261 throw_glaive Fluffy_Pillow 53.0/130: 41% fury momentum, out_of_range, vengeful_retreat_movement, blood_frenzy
1:48.539 Waiting 0.100 sec 53.0/130: 41% fury raid_movement, momentum, blood_frenzy
1:48.639 throw_glaive Fluffy_Pillow 53.0/130: 41% fury raid_movement, momentum, blood_frenzy
1:50.154 fel_rush Fluffy_Pillow 53.0/130: 41% fury raid_movement, momentum, blood_frenzy
1:50.558 auto_attack Fluffy_Pillow 78.0/130: 60% fury momentum, blood_frenzy
1:50.558 blade_dance Fluffy_Pillow 78.0/130: 60% fury momentum, blood_frenzy
1:51.837 Waiting 2.300 sec 43.0/130: 33% fury momentum, blood_frenzy
1:54.137 consume_magic Fluffy_Pillow 61.0/130: 47% fury momentum
1:54.137 chaos_strike Fluffy_Pillow 111.0/130: 85% fury momentum
1:55.514 Waiting 2.100 sec 71.0/130: 55% fury
1:57.614 throw_glaive Fluffy_Pillow 91.0/130: 70% fury
1:59.175 chaos_strike Fluffy_Pillow 91.0/130: 70% fury
2:00.554 blade_dance Fluffy_Pillow 71.0/130: 55% fury
2:01.932 fel_rush Fluffy_Pillow 36.0/130: 28% fury
2:02.306 Waiting 0.100 sec 61.0/130: 47% fury momentum
2:02.406 chaos_strike Fluffy_Pillow 92.0/130: 71% fury momentum
2:03.782 fury_of_the_illidari Fluffy_Pillow 52.0/130: 40% fury momentum
2:05.159 auto_attack Fluffy_Pillow 52.0/130: 40% fury momentum
2:05.159 Waiting 0.800 sec 52.0/130: 40% fury momentum
2:05.959 fel_rush Fluffy_Pillow 52.0/130: 40% fury
2:06.353 chaos_strike Fluffy_Pillow 77.0/130: 59% fury momentum
2:07.732 throw_glaive Fluffy_Pillow 57.0/130: 44% fury momentum
2:09.110 Waiting 0.400 sec 57.0/130: 44% fury momentum
2:09.510 blade_dance Fluffy_Pillow 57.0/130: 44% fury momentum
2:11.085 Waiting 0.100 sec 22.0/130: 17% fury
2:11.185 vengeful_retreat Fluffy_Pillow 22.0/130: 17% fury
2:11.361 Waiting 1.300 sec 22.0/130: 17% fury momentum, vengeful_retreat_movement
2:12.661 auto_attack Fluffy_Pillow 22.0/130: 17% fury momentum
2:12.661 Waiting 0.600 sec 22.0/130: 17% fury momentum
2:13.261 chaos_strike Fluffy_Pillow 56.0/130: 43% fury momentum
2:14.639 Waiting 1.000 sec 36.0/130: 28% fury momentum
2:15.639 chaos_strike Fluffy_Pillow 71.0/130: 55% fury
2:17.015 chaos_strike Fluffy_Pillow 51.0/130: 39% fury
2:18.392 Waiting 1.700 sec 11.0/130: 8% fury
2:20.092 fel_rush Fluffy_Pillow 11.0/130: 8% fury raid_movement
2:20.567 auto_attack Fluffy_Pillow 36.0/130: 28% fury momentum
2:20.567 blade_dance Fluffy_Pillow 36.0/130: 28% fury momentum
2:21.946 throw_glaive Fluffy_Pillow 1.0/130: 1% fury momentum
2:23.325 Waiting 0.800 sec 1.0/130: 1% fury momentum
2:24.125 fel_rush Fluffy_Pillow 1.0/130: 1% fury
2:24.547 Waiting 0.500 sec 26.0/130: 20% fury momentum
2:25.047 throw_glaive Fluffy_Pillow 26.0/130: 20% fury momentum
2:26.639 Waiting 0.900 sec 26.0/130: 20% fury momentum, blood_frenzy
2:27.539 eye_beam Fluffy_Pillow 73.0/130: 56% fury momentum, blood_frenzy
2:29.531 Waiting 0.300 sec 23.0/130: 18% fury metamorphosis, blood_frenzy
2:29.831 blade_dance Fluffy_Pillow 51.0/130: 39% fury blood_frenzy
2:31.112 Waiting 1.000 sec 16.0/130: 12% fury blood_frenzy
2:32.112 consume_magic Fluffy_Pillow 47.0/130: 36% fury blood_frenzy
2:32.112 chaos_strike Fluffy_Pillow 97.0/130: 75% fury blood_frenzy
2:33.392 chaos_strike Fluffy_Pillow 77.0/130: 59% fury blood_frenzy
2:34.672 throw_glaive Fluffy_Pillow 57.0/130: 44% fury blood_frenzy
2:35.950 Waiting 0.200 sec 57.0/130: 44% fury
2:36.150 vengeful_retreat Fluffy_Pillow 57.0/130: 44% fury raid_movement
2:36.361 auto_attack Fluffy_Pillow 57.0/130: 44% fury momentum, vengeful_retreat_movement
2:36.361 fel_barrage Fluffy_Pillow 57.0/130: 44% fury momentum, vengeful_retreat_movement
2:38.066 Waiting 0.300 sec 57.0/130: 44% fury momentum
2:38.366 blade_dance Fluffy_Pillow 57.0/130: 44% fury momentum
2:39.937 Waiting 1.200 sec 22.0/130: 17% fury momentum
2:41.137 chaos_strike Fluffy_Pillow 82.0/130: 63% fury
2:42.515 fel_rush Fluffy_Pillow 62.0/130: 48% fury
2:42.885 chaos_strike Fluffy_Pillow 87.0/130: 67% fury momentum
2:44.262 chaos_strike Fluffy_Pillow 47.0/130: 36% fury momentum
2:45.640 Waiting 0.300 sec 27.0/130: 21% fury momentum
2:45.940 chaos_strike Fluffy_Pillow 85.0/130: 65% fury momentum
2:47.317 chaos_strike Fluffy_Pillow 65.0/130: 50% fury
2:48.694 Waiting 1.400 sec 25.0/130: 19% fury
2:50.094 throw_glaive Fluffy_Pillow 25.0/130: 19% fury raid_movement
2:51.471 Waiting 0.100 sec 25.0/130: 19% fury raid_movement, blood_frenzy
2:51.571 throw_glaive Fluffy_Pillow 25.0/130: 19% fury raid_movement, blood_frenzy
2:53.095 auto_attack Fluffy_Pillow 25.0/130: 19% fury blood_frenzy
2:53.095 fel_rush Fluffy_Pillow 25.0/130: 19% fury blood_frenzy
2:53.489 blade_dance Fluffy_Pillow 50.0/130: 38% fury momentum, blood_frenzy
2:54.767 Waiting 2.400 sec 15.0/130: 12% fury momentum, blood_frenzy
2:57.167 fel_rush Fluffy_Pillow 29.0/130: 22% fury blood_frenzy
2:57.550 Waiting 2.200 sec 54.0/130: 42% fury momentum, blood_frenzy
2:59.750 chaos_strike Fluffy_Pillow 87.0/130: 67% fury momentum, blood_frenzy
3:01.028 throw_glaive Fluffy_Pillow 47.0/130: 36% fury momentum, blood_frenzy
3:02.308 vengeful_retreat Fluffy_Pillow 47.0/130: 36% fury blood_frenzy
3:02.308 blade_dance Fluffy_Pillow 47.0/130: 36% fury momentum, vengeful_retreat_movement, blood_frenzy
3:03.588 fury_of_the_illidari Fluffy_Pillow 12.0/130: 9% fury momentum, blood_frenzy
3:05.060 Waiting 1.300 sec 12.0/130: 9% fury momentum, blood_frenzy
3:06.360 chaos_strike Fluffy_Pillow 83.0/130: 64% fury blood_frenzy
3:07.638 Waiting 0.400 sec 43.0/130: 33% fury blood_frenzy
3:08.038 fel_rush Fluffy_Pillow 43.0/130: 33% fury raid_movement, blood_frenzy
3:08.394 fel_barrage Fluffy_Pillow 68.0/130: 52% fury raid_movement, momentum, blood_frenzy
3:09.996 auto_attack Fluffy_Pillow 68.0/130: 52% fury momentum
3:09.996 consume_magic Fluffy_Pillow 68.0/130: 52% fury momentum
3:09.996 throw_glaive Fluffy_Pillow 118.0/130: 91% fury momentum
3:11.372 chaos_strike Fluffy_Pillow 118.0/130: 91% fury momentum
3:12.749 chaos_strike Fluffy_Pillow 78.0/130: 60% fury
3:14.126 Waiting 0.700 sec 38.0/130: 29% fury
3:14.826 chaos_strike Fluffy_Pillow 103.0/130: 79% fury
3:16.204 chaos_strike Fluffy_Pillow 83.0/130: 64% fury
3:17.581 chaos_strike Fluffy_Pillow 63.0/130: 48% fury
3:18.958 Waiting 0.600 sec 23.0/130: 18% fury
3:19.558 chaos_strike Fluffy_Pillow 79.0/130: 61% fury
3:20.936 throw_glaive Fluffy_Pillow 39.0/130: 30% fury raid_movement
3:22.313 Waiting 0.700 sec 39.0/130: 30% fury raid_movement
3:23.013 auto_attack Fluffy_Pillow 39.0/130: 30% fury
3:23.013 blade_dance Fluffy_Pillow 39.0/130: 30% fury
3:24.391 fel_rush Fluffy_Pillow 4.0/130: 3% fury raid_movement
3:24.801 Waiting 0.200 sec 29.0/130: 22% fury raid_movement, momentum
3:25.001 auto_attack Fluffy_Pillow 29.0/130: 22% fury momentum
3:25.001 Waiting 1.300 sec 29.0/130: 22% fury momentum
3:26.301 throw_glaive Fluffy_Pillow 29.0/130: 22% fury momentum
3:27.845 consume_magic Fluffy_Pillow 29.0/130: 22% fury momentum
3:27.845 eye_beam Fluffy_Pillow 79.0/130: 61% fury momentum
3:29.914 vengeful_retreat Fluffy_Pillow 88.0/130: 68% fury
3:29.914 chaos_strike Fluffy_Pillow 88.0/130: 68% fury momentum, vengeful_retreat_movement
3:31.291 Waiting 0.700 sec 48.0/130: 37% fury momentum
3:31.991 blade_dance Fluffy_Pillow 48.0/130: 37% fury momentum
3:33.545 Waiting 0.900 sec 26.0/130: 20% fury momentum
3:34.445 fel_rush Fluffy_Pillow 26.0/130: 20% fury
3:34.816 Waiting 0.600 sec 51.0/130: 39% fury momentum
3:35.416 throw_glaive Fluffy_Pillow 51.0/130: 39% fury momentum
3:37.001 Waiting 2.100 sec 51.0/130: 39% fury momentum, blood_frenzy
3:39.101 chaos_strike Fluffy_Pillow 108.0/130: 83% fury blood_frenzy
3:40.380 Waiting 0.600 sec 68.0/130: 52% fury raid_movement, blood_frenzy
3:40.980 auto_attack Fluffy_Pillow 68.0/130: 52% fury blood_frenzy
3:40.980 chaos_strike Fluffy_Pillow 68.0/130: 52% fury blood_frenzy
3:42.258 Waiting 1.000 sec 28.0/130: 22% fury blood_frenzy
3:43.258 chaos_strike Fluffy_Pillow 64.0/130: 49% fury blood_frenzy
3:44.538 fel_rush Fluffy_Pillow 44.0/130: 34% fury blood_frenzy
3:44.888 chaos_strike Fluffy_Pillow 69.0/130: 53% fury momentum, blood_frenzy
3:46.167 consume_magic Fluffy_Pillow 49.0/130: 38% fury momentum
3:46.167 chaos_strike Fluffy_Pillow 99.0/130: 76% fury momentum
3:47.546 chaos_strike Fluffy_Pillow 79.0/130: 61% fury momentum
3:48.922 Waiting 1.100 sec 39.0/130: 30% fury blood_frenzy
3:50.022 throw_glaive Fluffy_Pillow 72.0/130: 55% fury raid_movement, blood_frenzy
3:51.302 Waiting 1.100 sec 72.0/130: 55% fury raid_movement, blood_frenzy
3:52.402 throw_glaive Fluffy_Pillow 72.0/130: 55% fury raid_movement, blood_frenzy
3:53.898 auto_attack Fluffy_Pillow 72.0/130: 55% fury blood_frenzy
3:53.898 blade_dance Fluffy_Pillow 72.0/130: 55% fury blood_frenzy
3:55.176 vengeful_retreat Fluffy_Pillow 37.0/130: 28% fury blood_frenzy
3:55.176 fel_barrage Fluffy_Pillow 37.0/130: 28% fury momentum, vengeful_retreat_movement, blood_frenzy
3:56.694 Waiting 0.300 sec 37.0/130: 28% fury raid_movement, momentum, blood_frenzy
3:56.994 auto_attack Fluffy_Pillow 37.0/130: 28% fury momentum, blood_frenzy
3:56.994 Waiting 2.200 sec 37.0/130: 28% fury momentum, blood_frenzy
3:59.194 fel_rush Fluffy_Pillow 37.0/130: 28% fury
3:59.666 Waiting 1.500 sec 62.0/130: 48% fury momentum
4:01.166 throw_glaive Fluffy_Pillow 62.0/130: 48% fury momentum
4:02.769 blade_dance Fluffy_Pillow 62.0/130: 48% fury momentum, blood_frenzy
4:04.048 fury_of_the_illidari Fluffy_Pillow 27.0/130: 21% fury blood_frenzy
4:05.329 Waiting 2.800 sec 27.0/130: 21% fury blood_frenzy
4:08.129 consume_magic Fluffy_Pillow 95.0/130: 73% fury blood_frenzy
4:08.129 metamorphosis Fluffy_Pillow 130.0/130: 100% fury blood_frenzy
4:09.218 potion Fluffy_Pillow 130.0/130: 100% fury metamorphosis, blood_frenzy
4:09.218 annihilation Fluffy_Pillow 130.0/130: 100% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:10.243 fel_rush Fluffy_Pillow 90.0/130: 69% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:10.662 annihilation Fluffy_Pillow 115.0/130: 88% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:11.685 annihilation Fluffy_Pillow 75.0/130: 58% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:12.707 throw_glaive Fluffy_Pillow 35.0/130: 27% fury raid_movement, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:13.730 auto_attack Fluffy_Pillow 35.0/130: 27% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:13.730 Waiting 1.800 sec 35.0/130: 27% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:15.530 annihilation Fluffy_Pillow 104.0/130: 80% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:16.553 annihilation Fluffy_Pillow 64.0/130: 49% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:17.577 Waiting 1.500 sec 24.0/130: 18% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:19.077 annihilation Fluffy_Pillow 86.0/130: 66% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:20.100 vengeful_retreat Fluffy_Pillow 46.0/130: 35% fury raid_movement, metamorphosis, blood_frenzy, potion_of_the_old_war
4:20.176 throw_glaive Fluffy_Pillow 46.0/130: 35% fury raid_movement, metamorphosis, momentum, vengeful_retreat_movement, blood_frenzy, potion_of_the_old_war
4:21.200 auto_attack Fluffy_Pillow 46.0/130: 35% fury metamorphosis, momentum, potion_of_the_old_war
4:21.200 death_sweep Fluffy_Pillow 46.0/130: 35% fury metamorphosis, momentum, potion_of_the_old_war
4:22.302 Waiting 0.900 sec 11.0/130: 8% fury metamorphosis, momentum, potion_of_the_old_war
4:23.202 consume_magic Fluffy_Pillow 38.0/130: 29% fury metamorphosis, momentum, potion_of_the_old_war
4:23.202 annihilation Fluffy_Pillow 88.0/130: 68% fury metamorphosis, momentum, potion_of_the_old_war
4:24.304 fel_rush Fluffy_Pillow 68.0/130: 52% fury metamorphosis, potion_of_the_old_war
4:24.758 annihilation Fluffy_Pillow 93.0/130: 72% fury metamorphosis, momentum, potion_of_the_old_war
4:25.860 throw_glaive Fluffy_Pillow 53.0/130: 41% fury metamorphosis, momentum, potion_of_the_old_war
4:26.964 death_sweep Fluffy_Pillow 53.0/130: 41% fury metamorphosis, momentum, potion_of_the_old_war
4:28.161 Waiting 0.200 sec 18.0/130: 14% fury raid_movement, metamorphosis, momentum, potion_of_the_old_war
4:28.361 fel_rush Fluffy_Pillow 18.0/130: 14% fury raid_movement, metamorphosis, potion_of_the_old_war
4:28.755 blur Fluffy_Pillow 43.0/130: 33% fury raid_movement, metamorphosis, momentum, potion_of_the_old_war
4:28.755 Waiting 0.200 sec 43.0/130: 33% fury raid_movement, metamorphosis, blur, momentum, potion_of_the_old_war
4:28.955 auto_attack Fluffy_Pillow 43.0/130: 33% fury metamorphosis, blur, momentum, potion_of_the_old_war
4:28.955 Waiting 2.000 sec 43.0/130: 33% fury metamorphosis, blur, momentum, potion_of_the_old_war
4:30.955 eye_beam Fluffy_Pillow 68.0/130: 52% fury metamorphosis, blur, momentum, potion_of_the_old_war
4:32.644 fel_rush Fluffy_Pillow 18.0/130: 14% fury metamorphosis, blur, potion_of_the_old_war
4:33.102 fel_barrage Fluffy_Pillow 43.0/130: 33% fury metamorphosis, blur, momentum, potion_of_the_old_war
4:34.510 death_sweep Fluffy_Pillow 43.0/130: 33% fury metamorphosis, blur, momentum
4:35.610 throw_glaive Fluffy_Pillow 8.0/130: 6% fury metamorphosis, blur, momentum, blood_frenzy
4:36.633 Waiting 3.100 sec 8.0/130: 6% fury metamorphosis, blur, momentum, blood_frenzy
4:39.733 blade_dance Fluffy_Pillow 73.0/130: 56% fury blood_frenzy
4:41.226 Waiting 1.400 sec 38.0/130: 29% fury blood_frenzy
4:42.626 chaos_strike Fluffy_Pillow 65.0/130: 50% fury blood_frenzy
4:43.906 fel_rush Fluffy_Pillow 45.0/130: 35% fury blood_frenzy
4:44.289 throw_glaive Fluffy_Pillow 70.0/130: 54% fury raid_movement, momentum, blood_frenzy
4:45.567 auto_attack Fluffy_Pillow 70.0/130: 54% fury momentum
4:45.567 chaos_strike Fluffy_Pillow 70.0/130: 54% fury momentum
4:46.944 Waiting 1.000 sec 30.0/130: 23% fury momentum
4:47.944 vengeful_retreat Fluffy_Pillow 30.0/130: 23% fury
4:47.944 Waiting 0.100 sec 30.0/130: 23% fury momentum, vengeful_retreat_movement
4:48.044 chaos_strike Fluffy_Pillow 62.0/130: 48% fury momentum, vengeful_retreat_movement
4:49.421 consume_magic Fluffy_Pillow 42.0/130: 32% fury momentum
4:49.421 chaos_strike Fluffy_Pillow 92.0/130: 71% fury momentum
4:50.798 throw_glaive Fluffy_Pillow 52.0/130: 40% fury raid_movement, momentum, blood_frenzy
4:52.075 Waiting 1.000 sec 52.0/130: 40% fury raid_movement, blood_frenzy
4:53.075 auto_attack Fluffy_Pillow 52.0/130: 40% fury blood_frenzy
4:53.075 blade_dance Fluffy_Pillow 52.0/130: 40% fury blood_frenzy
4:54.354 fel_rush Fluffy_Pillow 17.0/130: 13% fury blood_frenzy
4:54.732 Waiting 1.400 sec 42.0/130: 32% fury momentum, blood_frenzy
4:56.132 throw_glaive Fluffy_Pillow 60.0/130: 46% fury momentum, blood_frenzy
4:57.604 Waiting 3.400 sec 60.0/130: 46% fury momentum, blood_frenzy
5:01.004 auto_attack Fluffy_Pillow 60.0/130: 46% fury
5:01.004 Waiting 0.500 sec 60.0/130: 46% fury
5:01.504 blade_dance Fluffy_Pillow 60.0/130: 46% fury
5:03.117 Waiting 0.700 sec 25.0/130: 19% fury
5:03.817 fury_of_the_illidari Fluffy_Pillow 56.0/130: 43% fury
5:05.425 fel_rush Fluffy_Pillow 56.0/130: 43% fury
5:05.767 throw_glaive Fluffy_Pillow 94.0/130: 72% fury momentum
5:07.145 chaos_strike Fluffy_Pillow 94.0/130: 72% fury momentum
5:08.524 fel_barrage Fluffy_Pillow 74.0/130: 57% fury momentum
5:10.153 chaos_strike Fluffy_Pillow 74.0/130: 57% fury
5:11.530 chaos_strike Fluffy_Pillow 54.0/130: 42% fury
5:12.907 vengeful_retreat Fluffy_Pillow 50.0/130: 38% fury
5:12.944 chaos_strike Fluffy_Pillow 50.0/130: 38% fury momentum, vengeful_retreat_movement
5:14.324 throw_glaive Fluffy_Pillow 30.0/130: 23% fury momentum
5:15.775 Waiting 1.200 sec 30.0/130: 23% fury momentum
5:16.975 auto_attack Fluffy_Pillow 30.0/130: 23% fury
5:16.975 fel_rush Fluffy_Pillow 30.0/130: 23% fury
5:17.447 eye_beam Fluffy_Pillow 55.0/130: 42% fury momentum
5:19.521 Waiting 1.500 sec 30.0/130: 23% fury momentum, blood_frenzy
5:21.021 fel_rush Fluffy_Pillow 30.0/130: 23% fury blood_frenzy
5:21.444 chaos_strike Fluffy_Pillow 55.0/130: 42% fury momentum, blood_frenzy
5:22.722 Waiting 0.300 sec 35.0/130: 27% fury momentum, blood_frenzy
5:23.022 throw_glaive Fluffy_Pillow 35.0/130: 27% fury momentum, blood_frenzy
5:24.528 Waiting 1.500 sec 35.0/130: 27% fury momentum, blood_frenzy
5:26.028 chaos_strike Fluffy_Pillow 82.0/130: 63% fury blood_frenzy
5:27.307 chaos_strike Fluffy_Pillow 62.0/130: 48% fury blood_frenzy
5:28.585 chaos_strike Fluffy_Pillow 42.0/130: 32% fury blood_frenzy
5:29.864 Waiting 0.300 sec 22.0/130: 17% fury
5:30.164 consume_magic Fluffy_Pillow 22.0/130: 17% fury
5:30.164 chaos_strike Fluffy_Pillow 72.0/130: 55% fury
5:31.542 Waiting 0.500 sec 32.0/130: 25% fury
5:32.042 fel_rush Fluffy_Pillow 32.0/130: 25% fury raid_movement
5:32.444 throw_glaive Fluffy_Pillow 57.0/130: 44% fury raid_movement, momentum
5:33.821 auto_attack Fluffy_Pillow 57.0/130: 44% fury momentum
5:33.821 chaos_strike Fluffy_Pillow 57.0/130: 44% fury momentum
5:35.199 Waiting 1.100 sec 17.0/130: 13% fury momentum
5:36.299 chaos_strike Fluffy_Pillow 88.0/130: 68% fury
5:37.676 chaos_strike Fluffy_Pillow 68.0/130: 52% fury
5:39.054 vengeful_retreat Fluffy_Pillow 48.0/130: 37% fury
5:39.054 chaos_strike Fluffy_Pillow 48.0/130: 37% fury momentum, vengeful_retreat_movement
5:40.432 Waiting 0.500 sec 8.0/130: 6% fury momentum
5:40.932 throw_glaive Fluffy_Pillow 8.0/130: 6% fury momentum
5:42.464 chaos_strike Fluffy_Pillow 75.0/130: 58% fury momentum
5:43.841 Waiting 1.900 sec 35.0/130: 27% fury
5:45.741 chaos_strike Fluffy_Pillow 50.0/130: 38% fury
5:47.121 fel_rush Fluffy_Pillow 10.0/130: 8% fury
5:47.536 Waiting 1.500 sec 35.0/130: 27% fury momentum
5:49.036 auto_attack Fluffy_Pillow 35.0/130: 27% fury momentum
5:49.036 Waiting 1.000 sec 35.0/130: 27% fury momentum
5:50.036 throw_glaive Fluffy_Pillow 35.0/130: 27% fury momentum
5:51.620 fel_rush Fluffy_Pillow 35.0/130: 27% fury
5:52.020 blur Fluffy_Pillow 60.0/130: 46% fury momentum
5:52.020 chaos_strike Fluffy_Pillow 60.0/130: 46% fury blur, momentum
5:53.398 chaos_strike Fluffy_Pillow 40.0/130: 31% fury blur, momentum
5:54.774 Waiting 0.900 sec 0.0/130: 0% fury blur, momentum, blood_frenzy
5:55.674 fel_rush Fluffy_Pillow 0.0/130: 0% fury blur, blood_frenzy
5:56.066 Waiting 2.200 sec 25.0/130: 19% fury blur, momentum, blood_frenzy
5:58.266 chaos_strike Fluffy_Pillow 51.0/130: 39% fury blur, momentum, blood_frenzy
5:59.544 throw_glaive Fluffy_Pillow 31.0/130: 24% fury blur, momentum, blood_frenzy
6:00.820 Waiting 1.800 sec 31.0/130: 24% fury blur, blood_frenzy
6:02.620 eye_beam Fluffy_Pillow 68.0/130: 52% fury blood_frenzy
6:04.222 vengeful_retreat Fluffy_Pillow 18.0/130: 14% fury raid_movement, metamorphosis, blood_frenzy
6:04.222 auto_attack Fluffy_Pillow 18.0/130: 14% fury metamorphosis, momentum, vengeful_retreat_movement, blood_frenzy
6:04.222 fury_of_the_illidari Fluffy_Pillow 18.0/130: 14% fury metamorphosis, momentum, vengeful_retreat_movement, blood_frenzy
6:05.501 fel_barrage Fluffy_Pillow 18.0/130: 14% fury momentum, blood_frenzy
6:07.059 auto_attack Fluffy_Pillow 18.0/130: 14% fury momentum
6:07.059 Waiting 0.300 sec 18.0/130: 14% fury momentum
6:07.359 throw_glaive Fluffy_Pillow 18.0/130: 14% fury momentum
6:08.979 fel_rush Fluffy_Pillow 87.0/130: 67% fury
6:09.333 chaos_strike Fluffy_Pillow 112.0/130: 86% fury momentum
6:10.710 chaos_strike Fluffy_Pillow 72.0/130: 55% fury momentum
6:12.086 consume_magic Fluffy_Pillow 52.0/130: 40% fury momentum
6:12.086 chaos_strike Fluffy_Pillow 102.0/130: 78% fury momentum
6:13.462 chaos_strike Fluffy_Pillow 62.0/130: 48% fury
6:14.838 Waiting 2.300 sec 22.0/130: 17% fury
6:17.138 chaos_strike Fluffy_Pillow 47.0/130: 36% fury
6:18.517 Waiting 0.500 sec 7.0/130: 5% fury
6:19.017 fel_rush Fluffy_Pillow 7.0/130: 5% fury
6:19.393 throw_glaive Fluffy_Pillow 32.0/130: 25% fury momentum
6:20.770 Waiting 0.200 sec 32.0/130: 25% fury raid_movement, momentum
6:20.970 auto_attack Fluffy_Pillow 32.0/130: 25% fury momentum
6:20.970 Waiting 2.100 sec 32.0/130: 25% fury momentum
6:23.070 fel_rush Fluffy_Pillow 32.0/130: 25% fury
6:23.421 chaos_strike Fluffy_Pillow 57.0/130: 44% fury momentum, blood_frenzy
6:24.701 Waiting 0.800 sec 17.0/130: 13% fury momentum, blood_frenzy
6:25.501 throw_glaive Fluffy_Pillow 17.0/130: 13% fury momentum, blood_frenzy
6:26.984 chaos_strike Fluffy_Pillow 82.0/130: 63% fury momentum, blood_frenzy
6:28.262 chaos_strike Fluffy_Pillow 42.0/130: 32% fury blood_frenzy
6:29.540 vengeful_retreat Fluffy_Pillow 2.0/130: 2% fury blood_frenzy
6:29.540 Waiting 0.500 sec 2.0/130: 2% fury momentum, vengeful_retreat_movement, blood_frenzy
6:30.040 chaos_strike Fluffy_Pillow 70.0/130: 54% fury momentum, vengeful_retreat_movement, blood_frenzy
6:31.321 chaos_strike Fluffy_Pillow 50.0/130: 38% fury momentum, blood_frenzy

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8803 8478 0
Agility 25509 23802 13638 (9844)
Stamina 32965 32965 20166
Intellect 5328 5003 0
Spirit 2 2 0
Health 1977900 1977900 0
Fury 130 130 0
Crit 43.75% 42.68% 9338
Haste 9.23% 9.23% 2999
Damage / Heal Versatility 2.18% 2.18% 873
Attack Power 25509 23802 0
Mastery 19.92% 19.92% 4172
Armor 2062 2062 2062
Run Speed 8 0 0
Leech 1.37% 1.37% 314

Gear

Source Slot Average Item Level: 856.00
Local Head Dreadhide Hood
ilevel: 860, stats: { 276 Armor, +1424 AgiInt, +2136 Sta, +794 Crit, +561 Haste }
Local Neck Stormcharged Choker
ilevel: 840, stats: { +997 Sta, +1213 Crit, +555 Mastery }
Local Shoulders Mana-Saber Hide Shoulders
ilevel: 835, stats: { 235 Armor, +846 AgiInt, +1269 Sta, +621 Mastery, +304 Crit, +397 Avoidance }
Local Chest Chestguard of Insidious Desire
ilevel: 850, stats: { 329 Armor, +1945 Sta, +1297 AgiInt, +792 Crit, +512 Mastery }
Local Waist Forest-Lord's Waistwrap
ilevel: 865, stats: { 195 Armor, +1678 Sta, +1119 AgiInt, +673 Haste, +362 Mastery }
Local Legs Splotched Bloodfur Leggings
ilevel: 865, stats: { 303 Armor, +2237 Sta, +1491 AgiInt, +986 Crit, +394 Mastery }
Local Feet Biornskin Moccasins
ilevel: 845, stats: { 223 Armor, +929 AgiInt, +1393 Sta, +686 Crit, +274 Mastery }
Local Wrists Wristwraps of Broken Trust
ilevel: 855, stats: { 146 Armor, +1147 Sta, +765 AgiInt, +454 Mastery, +294 Crit }
Local Hands Mana-Lanced Gloves
ilevel: 870, stats: { 220 Armor, +1172 AgiInt, +1758 Sta, +640 Vers, +414 Mastery }
Local Finger1 Ring of Frozen Magic
ilevel: 870, stats: { +1319 Sta, +1188 Haste, +791 Crit }
Local Finger2 Twice-Warped Azsharan Signet
ilevel: 850, stats: { +1094 Sta, +1258 Crit, +577 Haste, +314 Leech }
Local Trinket1 Three-Toed Rabbit Foot
ilevel: 850, stats: { +1233 Agi, +932 Crit }
Local Trinket2 Bloodthirsty Instinct
ilevel: 850, stats: { +1233 Agi }, gems: { +150 Crit }
Local Back Drape of the Mana-Starved
ilevel: 860, stats: { 135 Armor, +1201 Sta, +801 StrAgiInt, +528 Crit, +233 Vers }
Local Main Hand Twinblades of the Deceiver
ilevel: 869, weapon: { 3933 - 7306, 2.6 }, stats: { +664 Agi, +996 Sta, +305 Crit, +293 Mastery }, relics: { +39 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Twinblades of the Deceiver
ilevel: 869, weapon: { 3933 - 7306, 2.6 }, stats: { +664 Agi, +996 Sta, +305 Crit, +293 Mastery }

Talents

Level
15 Fel Mastery (Havoc Demon Hunter) Chaos Cleave (Havoc Demon Hunter) Blind Fury (Havoc Demon Hunter)
30 Prepared (Havoc Demon Hunter) Demon Blades (Havoc Demon Hunter) Demonic Appetite (Havoc Demon Hunter)
45 Felblade First Blood (Havoc Demon Hunter) Bloodlet (Havoc Demon Hunter)
60 Netherwalk (Havoc Demon Hunter) Desperate Instincts (Havoc Demon Hunter) Soul Rending (Havoc Demon Hunter)
75 Momentum (Havoc Demon Hunter) Fel Eruption (Havoc Demon Hunter) Nemesis (Havoc Demon Hunter)
90 Master of the Glaive (Havoc Demon Hunter) Unleashed Power (Havoc Demon Hunter) Demon Reborn (Havoc Demon Hunter)
100 Chaos Blades (Havoc Demon Hunter) Fel Barrage (Havoc Demon Hunter) Demonic (Havoc Demon Hunter)

Profile

demonhunter="Táunks"
origin="https://us.api.battle.net/wow/character/thrall/Táunks/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/107/157266795-avatar.jpg"
level=110
race=blood_elf
role=attack
position=back
professions=skinning=800
talents=1233112
talent_override=fel_barrage,if=active_enemies>1|raid_event.adds.exists
artifact=3:0:0:0:0:1000:3:1001:3:1002:3:1003:3:1004:3:1006:3:1007:3:1010:1:1011:1:1012:1:1013:1:1014:1:1016:1:1330:1
spec=havoc

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war
actions.precombat+=/metamorphosis

# Executed every time the actor is available.
actions=auto_attack
# "Getting ready to use meta" conditions, this is used in a few places.
actions+=/variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
# Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
actions+=/variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
# Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on
# single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
actions+=/variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
actions+=/blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
actions+=/call_action_list,name=cooldown
# Fel Rush in at the start of combat.
actions+=/fel_rush,animation_cancel=1,if=time=0
actions+=/pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
actions+=/consume_magic
# Vengeful Retreat backwards through the target to minimize downtime.
actions+=/vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
# Fel Rush for Momentum and for fury from Fel Mastery.
actions+=/fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
# Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
actions+=/fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
actions+=/eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
actions+=/death_sweep,if=variable.blade_dance
actions+=/blade_dance,if=variable.blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
actions+=/fel_eruption
actions+=/felblade,if=fury.deficit>=30+buff.prepared.up*8
actions+=/annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
actions+=/eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
# If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
actions+=/throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
actions+=/chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
# Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
actions+=/demons_bite
actions+=/throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
actions+=/felblade,if=movement.distance|buff.out_of_range.up
actions+=/fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
actions+=/vengeful_retreat,if=movement.distance>15

actions.cooldown=nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
actions.cooldown+=/nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
actions.cooldown+=/nemesis,sync=metamorphosis,if=!raid_event.adds.exists
actions.cooldown+=/chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
actions.cooldown+=/metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
actions.cooldown+=/potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

head=dreadhide_hood,id=121296,bonus_id=3474/1522/3337
neck=stormcharged_choker,id=134497,bonus_id=1727/1492/1813
shoulders=manasaber_hide_shoulders,id=134330,bonus_id=3432/40/1497/1674
back=drape_of_the_manastarved,id=141543,bonus_id=1472
chest=chestguard_of_insidious_desire,id=137514,bonus_id=1727/1502/3336
wrists=wristwraps_of_broken_trust,id=139209,bonus_id=1807/1477/3336
hands=manalanced_gloves,id=134444,bonus_id=1727/1808/1522/3337
waist=forestlords_waistwrap,id=139198,bonus_id=1807/1487/3337
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1807/1487/3337
feet=biornskin_moccasins,id=134193,bonus_id=3474/1507/1674
finger1=ring_of_frozen_magic,id=141533,bonus_id=1482/3336
finger2=twicewarped_azsharan_signet,id=139238,bonus_id=1807/41/1472
trinket1=threetoed_rabbit_foot,id=134203,bonus_id=3432/603/1512/3337
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1808/1472,gems=150crit
main_hand=twinblades_of_the_deceiver,id=127829,bonus_id=719,gem_id=141277/136719/141255/0,relic_id=3432:1497:1674/1727:1492:1813/3432:1502:3336/0
off_hand=twinblades_of_the_deceiver,id=127830

# Gear Summary
# gear_ilvl=856.44
# gear_agility=13638
# gear_stamina=20166
# gear_crit_rating=9338
# gear_haste_rating=2999
# gear_mastery_rating=4172
# gear_versatility_rating=873
# gear_leech_rating=314
# gear_avoidance_rating=397
# gear_armor=2062

Illistan

Illistan : 205660 dps, 128936 dps to main target, 61400 dtps, 0 hps (0 aps), 61.6k TMI, 63.4k ETMI

  • Race: Blood Elf
  • Class: Demonhunter
  • Spec: Vengeance
  • Level: 110
  • Role: Tank
  • Position: front

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
205659.5 205659.5 209.9 / 0.102% 39601.4 / 19.3% 24407.6
DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max MSD Freq.   Window Bin Size
61400.3 41.54 / 0.07% 8386 / 13.7%       61.6k 12 / 0.02% 59.3k 64.0k 2.4k / 4.0%       20.5% 12.9% 29.7% 20.2       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.4 8.4 Pain 3.70% 60.2 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Illistan/advanced
Talents
  • 15: Agonizing Flames (Vengeance Demon Hunter)
  • 30: Feast of Souls (Vengeance Demon Hunter)
  • 45: Felblade
  • 60: Feed the Demon (Vengeance Demon Hunter)
  • 75: Concentrated Sigils (Vengeance Demon Hunter)
  • 90: Fel Devastation (Vengeance Demon Hunter)
  • 100: Last Resort (Vengeance Demon Hunter)
  • Talent Calculator
Artifact
Professions
  • herbalism: 339
  • enchanting: 59
Scale Factors for Illistan Damage Taken Per Second
Agi Crit Mastery Haste Vers
Scale Factors -0.29 -0.45 -0.51 -0.79 -0.83
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.05 0.05 0.05 0.05 0.05
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Mastery > Haste ~= Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-0.29, CritRating=-0.45, HasteRating=-0.79, MasteryRating=-0.51, Versatility=-0.83 )

Scale Factors for other metrics

Scale Factors for Illistan Damage Per Second
Agi Vers Mastery Crit Haste
Scale Factors 7.83 4.73 4.52 4.15 3.25
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.27 0.26 0.26 0.26 0.26
Gear Ranking
Optimizers
Ranking
  • Agi > Vers ~= Mastery > Crit > Haste
Pawn string ( Pawn: v1: "Illistan": Agility=7.83, CritRating=4.15, HasteRating=3.25, MasteryRating=4.52, Versatility=4.73 )
Scale Factors for Illistan Priority Target Damage Per Second
Agi Vers Crit Mastery Haste
Scale Factors 4.62 2.96 2.68 2.67 2.66
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.06 0.06 0.06 0.06 0.06
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit ~= Mastery ~= Haste
Pawn string ( Pawn: v1: "Illistan": Agility=4.62, CritRating=2.68, HasteRating=2.66, MasteryRating=2.67, Versatility=2.96 )
Scale Factors for Illistan Damage Per Second (Effective)
Agi Vers Mastery Crit Haste
Scale Factors 7.83 4.73 4.52 4.15 3.25
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Mastery > Crit > Haste
Pawn string ( Pawn: v1: "Illistan": Agility=7.83, CritRating=4.15, HasteRating=3.25, MasteryRating=4.52, Versatility=4.73 )
Scale Factors for Illistan Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Illistan Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Illistan Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Illistan Damage Taken Per Second
Agi Crit Mastery Haste Vers
Scale Factors -0.29 -0.45 -0.51 -0.79 -0.83
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.05 0.05 0.05 0.05 0.05
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Mastery > Haste ~= Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-0.29, CritRating=-0.45, HasteRating=-0.79, MasteryRating=-0.51, Versatility=-0.83 )
Scale Factors for Illistan Damage Taken
Agi Crit Mastery Haste Vers
Scale Factors -120.50 -181.98 -211.77 -317.82 -334.08
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Mastery > Haste > Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-120.50, CritRating=-181.98, HasteRating=-317.82, MasteryRating=-211.77, Versatility=-334.08 )
Scale Factors for Illistan Healing Taken Per Second
Agi Crit Mastery Haste Vers
Scale Factors -0.26 -0.43 -0.49 -0.75 -0.80
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Mastery > Haste > Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-0.26, CritRating=-0.43, HasteRating=-0.75, MasteryRating=-0.49, Versatility=-0.80 )
Scale Factors for Illistan Theck-Meloree Index
Agi Crit Haste Mastery Vers
Scale Factors -0.45 -0.27 -0.51 -0.33 -0.38
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Haste > Mastery > Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-0.45, CritRating=-0.27, HasteRating=-0.51, MasteryRating=-0.33, Versatility=-0.38 )
Scale Factors for IllistanTheck-Meloree Index (Effective)
Agi Crit Haste Mastery Vers
Scale Factors -0.09 -0.05 -0.16 -0.08 -0.11
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.01 0.01 0.01 0.01 0.01
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Haste > Mastery > Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-0.09, CritRating=-0.05, HasteRating=-0.16, MasteryRating=-0.08, Versatility=-0.11 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% B% Up%
Illistan 205660
auto_attack_mh 9764 4.8% 147.8 2.72sec 26479 12335 Direct 147.8 21365 42732 26479 42.9% 19.0% 6.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 147.82 147.82 0.00 0.00 2.1467 0.0000 3914067.67 5885816.06 33.50 12334.77 12334.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.09 35.24% 21854.78 21855 21855 21854.78 21855 21855 1138331 1673454 31.98
hit (blocked) 4.21 2.85% 15298.35 15298 15298 15042.84 0 15298 64359 135162 51.51
crit 58.72 39.72% 43709.57 43710 43710 43709.57 43710 43710 2566598 3773143 31.98
crit (blocked) 4.73 3.20% 30596.70 30597 30597 30293.76 0 30597 144780 304057 51.87
miss 28.08 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 4570 2.2% 138.6 2.90sec 13222 5756 Direct 138.6 10680 21365 13222 42.8% 19.0% 6.1%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 138.58 138.58 0.00 0.00 2.2969 0.0000 1832247.59 2755531.35 33.51 5756.39 5756.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.90 35.29% 10927.39 10927 10927 10927.39 10927 10927 534389 785602 31.98
hit (blocked) 3.99 2.88% 7649.17 7649 7649 7500.77 0 7649 30553 64166 51.37
crit 54.89 39.61% 21854.78 21855 21855 21854.78 21855 21855 1199526 1763417 31.98
crit (blocked) 4.43 3.20% 15298.35 15298 15298 15078.03 0 15298 67780 142347 51.63
miss 26.36 19.02% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Felblade 12336 6.0% 40.3 9.99sec 122570 91764 Direct 40.3 85817 171648 122570 42.8% 0.0% 7.5%  

Stats details: felblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.29 40.29 0.00 0.00 1.3357 0.0000 4938841.75 4938841.75 0.00 91764.21 91764.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.31 52.88% 85818.62 84452 92897 85822.76 84452 88674 1828683 1828683 0.00
hit (blocked) 1.73 4.30% 85798.19 84452 92897 70783.16 0 92897 148538 148538 0.00
crit 15.94 39.57% 171652.36 168903 185794 171657.84 168903 178555 2736808 2736808 0.00
crit (blocked) 1.31 3.25% 171594.93 168903 185794 125595.62 0 185794 224813 224813 0.00
 
 

Action details: felblade

Static Values
  • id:232893
  • school:physical
  • resource:none
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:pain<=70
Spelldata
  • id:232893
  • name:Felblade
  • school:physical
  • tooltip:
  • description:Charge to your target and deal $213243sw2 Fire damage. {$?s203513=false}[Shear has a chance to reset the cooldown of Felblade. |cFFFFFFFFGenerates ${{$213243s3=200}/10} Pain.|r][Demon's Bite has a chance to reset the cooldown of Felblade. |cFFFFFFFFGenerates {$213243s4=30} Fury.|r]
 
Fiery Brand 5647 2.8% 7.1 60.61sec 319061 0 Direct 7.1 223227 446453 319058 42.9% 0.0% 0.0%  

Stats details: fiery_brand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.08 7.08 6.96 0.00 0.0000 8.0000 2258765.62 2258765.62 0.00 40545.07 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.04 57.07% 223226.60 223227 223227 222400.58 0 223227 901859 901859 0.00
crit 3.04 42.93% 446453.19 446453 446453 437032.09 0 446453 1356907 1356907 0.00
 
 

Action details: fiery_brand

Static Values
  • id:204021
  • school:fire
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.demon_spikes.down&buff.metamorphosis.down
Spelldata
  • id:204021
  • name:Fiery Brand
  • school:fire
  • tooltip:Dealing {$s1=40}% less damage to the branding Demon Hunter.
  • description:Brand an enemy with a demonic symbol, instantly dealing $sw2 Fire damage and reducing the damage they do to you by {$s1=40}% for {$207744d=8 seconds}.
 
Immolation Aura 75079 36.3% 29.2 13.92sec 1020768 845964 Direct 697.0 29889 59788 42710 42.9% 0.0% 0.0%  

Stats details: immolation_aura

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.16 696.96 0.00 0.00 1.2066 0.0000 29766931.87 29766931.87 0.00 845963.90 845963.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 398.11 57.12% 29888.90 20152 95321 29900.17 26125 34224 11899150 11899150 0.00
crit 298.85 42.88% 59788.37 40305 190642 59812.38 50453 69674 17867781 17867781 0.00
 
 

Action details: immolation_aura

Static Values
  • id:178740
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:pain<=80
Spelldata
  • id:178740
  • name:Immolation Aura
  • school:fire
  • tooltip:Burns nearby enemies for {$178741s1=0} Fire damage every $178740t1 sec.$?a207548[ Movement speed increased by $w4%.][]
  • description:Engulf yourself in flames, instantly causing {$187727s1=0} Fire damage to enemies within $187727A1 yards and radiating {$178741s1=0} Fire damage every sec. Lasts {$d=6 seconds}. |cFFFFFFFFGenerates ${{$s3=80}/10+{$178741s2=20}/10*{$d=6 seconds}} Pain over {$d=6 seconds}.|r
 
Infernal Strike 26069 12.6% 21.3 20.10sec 485229 0 Direct 71.7 100867 201752 144119 42.9% 0.0% 0.0%  

Stats details: infernal_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.30 71.71 0.00 0.00 0.0000 0.0000 10335104.15 10335104.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.97 57.13% 100866.52 99833 109817 100874.30 99833 102422 4132379 4132379 0.00
crit 30.74 42.87% 201751.63 199667 219633 201765.37 199667 207154 6202725 6202725 0.00
 
 

Action details: infernal_strike

Static Values
  • id:189110
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&artifact.fiery_demise.enabled&dot.fiery_brand.ticking
Spelldata
  • id:189110
  • name:Infernal Strike
  • school:physical
  • tooltip:
  • description:Leap through the air toward a targeted location, dealing {$189112s1=1} Fire damage to all enemies within $189112a1 yards.
 
Shear 32909 16.1% 156.4 2.54sec 84312 63010 Direct 156.4 59014 118054 84312 42.8% 0.0% 7.5%  

Stats details: shear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 156.36 156.36 0.00 0.00 1.3381 0.0000 13183208.18 19826564.46 33.51 63009.72 63009.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.63 52.84% 60380.31 60380 60380 60380.31 60380 60380 4988969 7334257 31.98
hit (blocked) 6.74 4.31% 42266.21 42266 42266 42211.26 0 42266 284797 598112 52.32
crit 61.99 39.65% 120760.61 120761 120761 120760.61 120761 120761 7486349 11005642 31.98
crit (blocked) 5.01 3.20% 84532.43 84532 84532 83982.91 0 84532 423093 888553 52.04
 
 

Action details: shear

Static Values
  • id:203782
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203782
  • name:Shear
  • school:physical
  • tooltip:
  • description:Shears an enemy for $sw2 Physical damage, and has a small chance to shatter a Lesser Soul Fragment from your target that heals you for {$203794s1=0} health when consumed. |cFFFFFFFFGenerates ${$m3/10} Pain.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.70
 
Sigil of Flame 11236 5.5% 13.3 31.01sec 335618 279540 Direct 34.9 52734 105462 75395 43.0% 0.0% 0.0%  
Periodic 68.9 18706 37414 26735 42.9% 0.0% 0.0% 34.4%

Stats details: sigil_of_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.32 34.88 68.88 68.88 1.2007 2.0000 4471248.66 4471248.66 0.00 29078.46 279540.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.89 57.02% 52733.86 51156 56272 52654.38 51156 54993 1048804 1048804 0.00
crit 14.99 42.98% 105462.31 102312 112543 105295.62 102312 110497 1580849 1580849 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.3 57.09% 18706.07 18602 20462 18700.90 18602 19222 735577 735577 0.00
crit 29.6 42.91% 37413.70 37204 40925 37403.82 37204 38544 1106019 1106019 0.00
 
 

Action details: sigil_of_flame

Static Values
  • id:204596
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains-delay<=0.3*duration
Spelldata
  • id:204596
  • name:Sigil of Flame
  • school:physical
  • tooltip:Sigil of Flame is active.
  • description:Place a Sigil of Flame at the target location that activates after {$d=2 seconds}. Deals {$204598s1=0} Fire damage, and an additional $204598o2 Fire damage over {$204598d=6 seconds}, to all enemies affected by the sigil.
 
Soul Carver 9402 4.6% 7.1 60.64sec 531782 382155 Direct 14.1 109788 219325 156688 42.8% 0.0% 7.5%  
Periodic 21.1 51157 102315 73141 43.0% 0.0% 0.0% 5.3%

Stats details: soul_carver

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.07 14.14 21.12 21.12 1.3916 1.0000 3760020.08 3760020.08 0.00 121463.37 382154.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.48 52.88% 109766.71 73153 146307 109768.79 0 146307 820797 820797 0.00
hit (blocked) 0.61 4.30% 110054.79 73153 146307 50587.31 0 146307 66927 66927 0.00
crit 5.60 39.57% 219450.92 146307 292613 219318.42 0 292613 1227885 1227885 0.00
crit (blocked) 0.46 3.24% 217784.80 146307 292613 80627.70 0 292613 99850 99850 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.0 57.03% 51157.42 51157 51157 51157.42 51157 51157 616074 616074 0.00
crit 9.1 42.97% 102314.85 102315 102315 102314.85 102315 102315 928488 928488 0.00
 
 

Action details: soul_carver

Static Values
  • id:207407
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.fiery_brand.ticking
Spelldata
  • id:207407
  • name:Soul Carver
  • school:fire
  • tooltip:Suffering {$s1=1} Fire damage every $t sec.
  • description:Carve into the soul of your target, dealing ${$sw2+$214743sw1} Fire damage and an additional ${3*{$s1=1}} Fire damage over {$d=3 seconds}. Immediately shatters {$s4=2} Lesser Soul Fragments from the target and 1 additional Lesser Soul Fragment every $t sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.350000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.41
 
Soul Cleave 18649 9.1% 44.4 8.99sec 168495 125071 Direct 44.4 117939 235868 168495 42.9% 0.0% 7.6%  

Stats details: soul_cleave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.35 44.35 0.00 0.00 1.3472 0.0000 7472877.26 11241215.11 33.52 125071.17 125071.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.42 52.81% 120672.28 60934 121869 120660.17 114833 121869 2826449 4155148 31.98
hit (blocked) 1.91 4.32% 84509.45 43198 85308 72424.38 0 85308 161834 339873 44.90
crit 17.57 39.62% 241345.10 122035 243737 241331.83 227245 243737 4241093 6234809 31.98
crit (blocked) 1.44 3.25% 169046.47 94547 170616 128844.37 0 170616 243501 511385 39.93
 
 

Action details: soul_cleave

Static Values
  • id:228477
  • school:physical
  • resource:pain
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:30.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_fragments=5
Spelldata
  • id:228477
  • name:Soul Cleave
  • school:physical
  • tooltip:
  • description:Viciously strike all enemies in front of you for up to $<cleaveDamage> Physical damage and heal yourself for up to $<cleaveHeal>, based on Pain spent. Consumes all Soul Fragments within {$s1=25} yds.
 
Simple Action Stats Execute Interval
Illistan
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
 
Consume Soul (_lesser) 64.4 6.15sec

Stats details: consume_soul_lesser

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 64.35 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: consume_soul_lesser

Static Values
  • id:203794
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
Spelldata
  • id:203794
  • name:Consume Soul
  • school:shadow
  • tooltip:
  • description:Consume a Lesser Soul Fragment, healing you for {$s1=0} health.
 
Demon Spikes 36.1 11.18sec

Stats details: demon_spikes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.09 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: demon_spikes

Static Values
  • id:203720
  • school:physical
  • resource:pain
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2|buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down
Spelldata
  • id:203720
  • name:Demon Spikes
  • school:physical
  • tooltip:
  • description:Surge with fel power, increasing your Parry chance by {$203819s1=20}% and reducing Physical damage taken by {$203819s2=20}% for {$203819d=6 seconds}.
 
Empower Wards 11.3 36.89sec

Stats details: empower_wards

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.26 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: empower_wards

Static Values
  • id:218256
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.casting.up
Spelldata
  • id:218256
  • name:Empower Wards
  • school:fire
  • tooltip:Magical damage taken reduced by {$s1=30}%.
  • description:Reduces magical damage taken by {$s1=30}% for {$d=6 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
 
potion 1.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Soul Cleave (_heal) 44.4 8.99sec

Stats details: soul_cleave_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 44.35 0.00 131.71 0.00 0.0000 1.9971 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_cleave_heal

Static Values
  • id:228477
  • school:physical
  • resource:pain
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
Spelldata
  • id:228477
  • name:Soul Cleave
  • school:physical
  • tooltip:
  • description:Viciously strike all enemies in front of you for up to $<cleaveDamage> Physical damage and heal yourself for up to $<cleaveHeal>, based on Pain spent. Consumes all Soul Fragments within {$s1=25} yds.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Frenzy 14.2 8.7 28.4sec 17.2sec 45.21% 45.21% 8.7(8.7) 13.7

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2743.21

Stack Uptimes

  • blood_frenzy_1:45.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 13.36% 0.0(0.0) 1.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Defensive Spikes 36.1 0.0 11.2sec 11.2sec 26.96% 25.72% 0.0(0.0) 35.8

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_defensive_spikes
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10

Stack Uptimes

  • defensive_spikes_1:26.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212871
  • name:Defensive Spikes
  • tooltip:
  • description:{$@spelldesc212829=Increases your chance to parry by an additional {$212871s1=10}% for the first {$212871d=3 seconds} after activating Demon Spikes.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Demon Spikes 36.1 0.0 11.2sec 11.2sec 53.72% 53.54% 0.0(0.0) 35.6

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_demon_spikes
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • demon_spikes_1:53.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203819
  • name:Demon Spikes
  • tooltip:Parry chance increased by $w1%. Physical damage taken reduced by ${-$W2}.2%.
  • description:{$@spelldesc203720=Surge with fel power, increasing your Parry chance by {$203819s1=20}% and reducing Physical damage taken by {$203819s2=20}% for {$203819d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Empower Wards 11.3 0.0 36.9sec 36.9sec 16.77% 17.88% 0.0(0.0) 11.1

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_empower_wards
  • max_stacks:1
  • duration:6.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.30

Stack Uptimes

  • empower_wards_1:16.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:218256
  • name:Empower Wards
  • tooltip:Magical damage taken reduced by {$s1=30}%.
  • description:Reduces magical damage taken by {$s1=30}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:20.00
  • default_chance:100.00%
Immolation Aura 29.2 0.0 13.9sec 13.9sec 43.37% 39.90% 173.5(173.5) 28.7

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_immolation_aura
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • immolation_aura_1:43.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:178740
  • name:Immolation Aura
  • tooltip:Burns nearby enemies for {$178741s1=0} Fire damage every $178740t1 sec.$?a207548[ Movement speed increased by $w4%.][]
  • description:Engulf yourself in flames, instantly causing {$187727s1=0} Fire damage to enemies within $187727A1 yards and radiating {$178741s1=0} Fire damage every sec. Lasts {$d=6 seconds}. |cFFFFFFFFGenerates ${{$s3=80}/10+{$178741s2=20}/10*{$d=6 seconds}} Pain over {$d=6 seconds}.|r
  • max_stacks:0
  • duration:6.00
  • cooldown:15.00
  • default_chance:0.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 9.75% 9.75% 2.0(2.0) 0.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:9.75%

Trigger Attempt Success

  • trigger_pct:100.00%
Unbending Potion 1.0 0.0 0.0sec 0.0sec 5.82% 5.82% 0.0(0.0) 1.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_unbending_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:bonus_armor
  • amount:3500.00

Stack Uptimes

  • unbending_potion_1:5.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188029
  • name:Unbending Potion
  • tooltip:Armor increased by {$s1=3500}.
  • description:Increases your Armor by {$s1=3500} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Illistan
demon_spikes Pain 36.1 721.8 20.0 20.0 0.0
soul_cleave Pain 44.4 2635.0 59.4 59.4 2836.0
Resource Gains Type Count Total Average Overflow
damage_taken Pain 255.46 460.71 (13.51%) 1.80 0.05 0.01%
immolation_aura Pain 29.16 233.29 (6.84%) 8.00 0.00 0.00%
immolation_aura_tick Pain 173.47 346.87 (10.17%) 2.00 0.07 0.02%
felblade_dmg Pain 40.29 805.87 (23.63%) 20.00 0.00 0.00%
shear Pain 156.36 1563.62 (45.85%) 10.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 60994.98 61424.59
Pain 8.51 8.38
Combat End Resource Mean Min Max
Pain 53.71 0.00 95.83

Benefits & Uptimes

Benefits %
Uptimes %
Pain Cap 0.0%

Procs

Count Interval
parry_haste 32.1 12.3sec
soul_fragment_lesser 74.1 6.0sec
felblade_reset 25.2 15.8sec
soul_fragment_overflow 2.0 100.2sec

Statistics & Data Analysis

Fight Length
Sample Data Illistan Fight Length
Count 9999
Mean 400.62
Minimum 307.54
Maximum 499.01
Spread ( max - min ) 191.47
Range [ ( max - min ) / 2 * 100% ] 23.90%
DPS
Sample Data Illistan Damage Per Second
Count 9999
Mean 205659.52
Minimum 176666.22
Maximum 242304.78
Spread ( max - min ) 65638.56
Range [ ( max - min ) / 2 * 100% ] 15.96%
Standard Deviation 10708.6528
5th Percentile 189917.99
95th Percentile 224373.90
( 95th Percentile - 5th Percentile ) 34455.90
Mean Distribution
Standard Deviation 107.0919
95.00% Confidence Intervall ( 205449.62 - 205869.41 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 104
0.1% Error 10415
0.1 Scale Factor Error with Delta=300 978933
0.05 Scale Factor Error with Delta=300 3915735
0.01 Scale Factor Error with Delta=300 97893384
Priority Target DPS
Sample Data Illistan Priority Target Damage Per Second
Count 9999
Mean 128935.52
Minimum 119959.49
Maximum 138734.50
Spread ( max - min ) 18775.02
Range [ ( max - min ) / 2 * 100% ] 7.28%
Standard Deviation 2364.0569
5th Percentile 125087.88
95th Percentile 132843.28
( 95th Percentile - 5th Percentile ) 7755.41
Mean Distribution
Standard Deviation 23.6418
95.00% Confidence Intervall ( 128889.19 - 128981.86 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1291
0.1 Scale Factor Error with Delta=300 47708
0.05 Scale Factor Error with Delta=300 190835
0.01 Scale Factor Error with Delta=300 4770891
DPS(e)
Sample Data Illistan Damage Per Second (Effective)
Count 9999
Mean 205659.52
Minimum 176666.22
Maximum 242304.78
Spread ( max - min ) 65638.56
Range [ ( max - min ) / 2 * 100% ] 15.96%
Damage
Sample Data Illistan Damage
Count 9999
Mean 81933312.83
Minimum 65542893.88
Maximum 97530916.61
Spread ( max - min ) 31988022.73
Range [ ( max - min ) / 2 * 100% ] 19.52%
DTPS
Sample Data Illistan Damage Taken Per Second
Count 9999
Mean 61400.27
Minimum 45079.74
Maximum 69172.15
Spread ( max - min ) 24092.41
Range [ ( max - min ) / 2 * 100% ] 19.62%
Standard Deviation 2119.4368
5th Percentile 57839.07
95th Percentile 64856.14
( 95th Percentile - 5th Percentile ) 7017.07
Mean Distribution
Standard Deviation 21.1954
95.00% Confidence Intervall ( 61358.73 - 61441.81 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4577
0.1 Scale Factor Error with Delta=300 38346
0.05 Scale Factor Error with Delta=300 153385
0.01 Scale Factor Error with Delta=300 3834640
HPS
Sample Data Illistan Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Illistan Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Illistan Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Illistan Healing Taken Per Second
Count 9999
Mean 60966.04
Minimum 44848.00
Maximum 68627.42
Spread ( max - min ) 23779.42
Range [ ( max - min ) / 2 * 100% ] 19.50%
TMI
Sample Data Illistan Theck-Meloree Index
Count 9999
Mean 61565.55
Minimum 59303.50
Maximum 63993.44
Spread ( max - min ) 4689.94
Range [ ( max - min ) / 2 * 100% ] 3.81%
Standard Deviation 626.3931
5th Percentile 60533.47
95th Percentile 62591.67
( 95th Percentile - 5th Percentile ) 2058.19
Mean Distribution
Standard Deviation 6.2642
95.00% Confidence Intervall ( 61553.27 - 61577.83 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 3
0.1% Error 397
0.1 Scale Factor Error with Delta=300 3349
0.05 Scale Factor Error with Delta=300 13397
0.01 Scale Factor Error with Delta=300 334948
ETMI
Sample Data IllistanTheck-Meloree Index (Effective)
Count 9999
Mean 63385.22
Minimum 62360.59
Maximum 64801.84
Spread ( max - min ) 2441.25
Range [ ( max - min ) / 2 * 100% ] 1.93%
Standard Deviation 336.6733
5th Percentile 62864.05
95th Percentile 63964.31
( 95th Percentile - 5th Percentile ) 1100.26
Mean Distribution
Standard Deviation 3.3669
95.00% Confidence Intervall ( 63378.62 - 63391.82 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 1
0.1% Error 108
0.1 Scale Factor Error with Delta=300 967
0.05 Scale Factor Error with Delta=300 3870
0.01 Scale Factor Error with Delta=300 96761
MSD
Sample Data Illistan Max Spike Value
Count 2503
Mean 20.50
Minimum 12.93
Maximum 29.67
Spread ( max - min ) 16.74
Range [ ( max - min ) / 2 * 100% ] 40.84%
Standard Deviation 2.5732
5th Percentile 16.61
95th Percentile 25.05
( 95th Percentile - 5th Percentile ) 8.44
Mean Distribution
Standard Deviation 0.0514
95.00% Confidence Intervall ( 20.40 - 20.60 )
Normalized 95.00% Confidence Intervall ( 99.51% - 100.49% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 605
0.1% Error 60531
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 5

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=unbending_potion
Default action list Executed every time the actor is available.
# count action,conditions
5 33.65 auto_attack
6 7.32 fiery_brand,if=buff.demon_spikes.down&buff.metamorphosis.down
7 36.14 demon_spikes,if=charges=2|buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down
8 11.26 empower_wards,if=debuff.casting.up
9 7.39 infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&artifact.fiery_demise.enabled&dot.fiery_brand.ticking
A 15.17 infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&(!artifact.fiery_demise.enabled|(max_charges-charges_fractional)*recharge_time<cooldown.fiery_brand.remains+5)&(cooldown.sigil_of_flame.remains>7|charges=2)
0.00 spirit_bomb,if=debuff.frailty.down
B 7.07 soul_carver,if=dot.fiery_brand.ticking
C 29.28 immolation_aura,if=pain<=80
D 40.34 felblade,if=pain<=70
0.00 soul_barrier
E 6.99 soul_cleave,if=soul_fragments=5
0.00 metamorphosis,if=buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down&incoming_damage_5s>health.max*0.70
0.00 fel_devastation,if=incoming_damage_5s>health.max*0.70
0.00 soul_cleave,if=incoming_damage_5s>=health.max*0.70
0.00 fel_eruption
F 13.33 sigil_of_flame,if=remains-delay<=0.3*duration
0.00 fracture,if=pain>=80&soul_fragments<4&incoming_damage_4s<=health.max*0.20
G 37.36 soul_cleave,if=pain>=80
H 156.36 shear

Sample Sequence

0124569B9C8D7FHDEHD7HHHC5HH7HGHHD7A5HHHGCHH75HHDGHFHCH7HHH8AGDH5HG7CH5HHHHG7D5HCDF6BGH9DH7HEC85HHA5HH7DHGHHCD5GHD7FHHGAHCDH5G75H8HHHCHG7D5HHF6BHE9CD7HHHA5HEH7HHCDGH8HHH75HFHGCADHHG7H5HHHCHAG7DHHHG6F85BCHDEH7HHA5HHH7C5HHEDHDG7HHCF5HHGAH78DHHC5HGH5H7HADGHHCD8G6BF5EHD7HCA5HH7HHHG5HD7HCDGHHHFH775HACG8D5HHG7DHDC5HGDHH7HFGD6B95CHD9EH7HHDHG7C8H5HHHHGDF7HCDAH5GHHHH7HHGCADHG5HD7HHH8FH6BECH95DG7HHHHH7DC

Sample Sequence Table

time name target resources buffs
Pre flask Illistan 0.0/100: 0% pain
Pre food Illistan 0.0/100: 0% pain
Pre augmentation Illistan 0.0/100: 0% pain
Pre potion Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 auto_attack Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 fiery_brand Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 infernal_strike Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 soul_carver Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:01.432 infernal_strike Fluffy_Pillow 0.0/100: 0% pain bloodlust, unbending_potion
0:01.432 immolation_aura Fluffy_Pillow 0.0/100: 0% pain bloodlust, unbending_potion
0:02.032 empower_wards Fluffy_Pillow 8.0/100: 8% pain bloodlust, empower_wards, immolation_aura, unbending_potion
0:02.238 felblade Fluffy_Pillow 8.0/100: 8% pain bloodlust, empower_wards, immolation_aura, unbending_potion
0:02.238 demon_spikes Fluffy_Pillow 8.0/100: 8% pain bloodlust, defensive_spikes, demon_spikes, empower_wards, immolation_aura, unbending_potion
0:03.340 sigil_of_flame Fluffy_Pillow 10.0/100: 10% pain bloodlust, defensive_spikes, demon_spikes, empower_wards, immolation_aura, unbending_potion
0:04.148 shear Fluffy_Pillow 12.0/100: 12% pain bloodlust, defensive_spikes, demon_spikes, empower_wards, immolation_aura, unbending_potion
0:05.249 felblade Fluffy_Pillow 25.3/100: 25% pain bloodlust, demon_spikes, empower_wards, immolation_aura, blood_frenzy, unbending_potion
0:06.270 soul_cleave Fluffy_Pillow 48.3/100: 48% pain bloodlust, demon_spikes, empower_wards, immolation_aura, blood_frenzy, unbending_potion
0:07.289 shear Fluffy_Pillow 3.6/100: 4% pain bloodlust, demon_spikes, empower_wards, immolation_aura, blood_frenzy, unbending_potion
0:08.311 felblade Fluffy_Pillow 15.6/100: 16% pain bloodlust, blood_frenzy, unbending_potion
0:08.311 demon_spikes Fluffy_Pillow 15.6/100: 16% pain bloodlust, defensive_spikes, demon_spikes, blood_frenzy, unbending_potion
0:09.332 shear Fluffy_Pillow 16.6/100: 17% pain bloodlust, defensive_spikes, demon_spikes, blood_frenzy, unbending_potion
0:10.352 shear Fluffy_Pillow 28.3/100: 28% pain bloodlust, defensive_spikes, demon_spikes, blood_frenzy, unbending_potion
0:11.372 shear Fluffy_Pillow 39.3/100: 39% pain bloodlust, demon_spikes, blood_frenzy, unbending_potion
0:12.392 immolation_aura Fluffy_Pillow 50.9/100: 51% pain bloodlust, raid_movement, demon_spikes, blood_frenzy, unbending_potion
0:13.147 auto_attack Fluffy_Pillow 59.8/100: 60% pain bloodlust, demon_spikes, immolation_aura, blood_frenzy, unbending_potion
0:13.147 shear Fluffy_Pillow 59.8/100: 60% pain bloodlust, demon_spikes, immolation_aura, blood_frenzy, unbending_potion
0:14.167 shear Fluffy_Pillow 73.5/100: 74% pain bloodlust, demon_spikes, immolation_aura, blood_frenzy, unbending_potion
0:14.367 demon_spikes Fluffy_Pillow 63.5/100: 64% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy, unbending_potion
0:15.189 shear Fluffy_Pillow 66.5/100: 66% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, unbending_potion
0:16.290 soul_cleave Fluffy_Pillow 80.1/100: 80% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, unbending_potion
0:17.392 shear Fluffy_Pillow 23.1/100: 23% pain bloodlust, demon_spikes, immolation_aura, unbending_potion
0:18.493 shear Fluffy_Pillow 38.6/100: 39% pain bloodlust, demon_spikes, unbending_potion
0:19.595 felblade Fluffy_Pillow 49.5/100: 50% pain bloodlust, demon_spikes, unbending_potion
0:20.395 demon_spikes Fluffy_Pillow 51.1/100: 51% pain bloodlust, raid_movement, defensive_spikes, demon_spikes, unbending_potion
0:20.698 infernal_strike Fluffy_Pillow 51.1/100: 51% pain bloodlust, raid_movement, defensive_spikes, demon_spikes, unbending_potion
0:20.698 auto_attack Fluffy_Pillow 51.1/100: 51% pain bloodlust, defensive_spikes, demon_spikes, unbending_potion
0:20.698 shear Fluffy_Pillow 51.1/100: 51% pain bloodlust, defensive_spikes, demon_spikes, unbending_potion
0:21.798 shear Fluffy_Pillow 62.1/100: 62% pain bloodlust, defensive_spikes, demon_spikes, unbending_potion
0:22.900 shear Fluffy_Pillow 72.1/100: 72% pain bloodlust, defensive_spikes, demon_spikes, unbending_potion
0:24.001 soul_cleave Fluffy_Pillow 83.1/100: 83% pain bloodlust, demon_spikes
0:25.102 immolation_aura Fluffy_Pillow 23.1/100: 23% pain bloodlust, demon_spikes
0:25.909 shear Fluffy_Pillow 31.1/100: 31% pain bloodlust, demon_spikes, immolation_aura
0:27.009 shear Fluffy_Pillow 43.1/100: 43% pain bloodlust, immolation_aura
0:27.807 demon_spikes Fluffy_Pillow 35.1/100: 35% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura
0:28.112 Waiting 0.800 sec 39.0/100: 39% pain bloodlust, raid_movement, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
0:28.912 auto_attack Fluffy_Pillow 39.0/100: 39% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
0:28.912 shear Fluffy_Pillow 39.0/100: 39% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
0:29.932 shear Fluffy_Pillow 51.0/100: 51% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
0:30.954 felblade Fluffy_Pillow 63.0/100: 63% pain bloodlust, demon_spikes, immolation_aura, blood_frenzy
0:31.974 soul_cleave Fluffy_Pillow 85.0/100: 85% pain bloodlust, demon_spikes, blood_frenzy
0:32.994 shear Fluffy_Pillow 25.0/100: 25% pain bloodlust, demon_spikes, blood_frenzy
0:34.015 sigil_of_flame Fluffy_Pillow 38.1/100: 38% pain bloodlust, blood_frenzy
0:34.770 shear Fluffy_Pillow 38.1/100: 38% pain bloodlust, blood_frenzy
0:35.791 immolation_aura Fluffy_Pillow 48.1/100: 48% pain bloodlust, blood_frenzy
0:36.544 shear Fluffy_Pillow 62.7/100: 63% pain bloodlust, immolation_aura, blood_frenzy
0:36.990 demon_spikes Fluffy_Pillow 54.7/100: 55% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
0:37.566 shear Fluffy_Pillow 54.7/100: 55% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
0:38.587 shear Fluffy_Pillow 66.7/100: 67% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
0:39.607 shear Fluffy_Pillow 78.7/100: 79% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
0:40.107 empower_wards Fluffy_Pillow 90.7/100: 91% pain bloodlust, demon_spikes, empower_wards, immolation_aura
0:40.628 infernal_strike Fluffy_Pillow 90.7/100: 91% pain bloodlust, demon_spikes, empower_wards, immolation_aura
0:40.628 soul_cleave Fluffy_Pillow 90.7/100: 91% pain bloodlust, demon_spikes, empower_wards, immolation_aura
0:41.729 felblade Fluffy_Pillow 32.7/100: 33% pain demon_spikes, empower_wards, immolation_aura
0:43.161 shear Fluffy_Pillow 58.2/100: 58% pain empower_wards
0:44.592 Waiting 0.600 sec 71.3/100: 71% pain raid_movement, empower_wards
0:45.192 auto_attack Fluffy_Pillow 71.3/100: 71% pain empower_wards
0:45.192 shear Fluffy_Pillow 71.3/100: 71% pain empower_wards
0:46.625 soul_cleave Fluffy_Pillow 84.9/100: 85% pain
0:47.451 demon_spikes Fluffy_Pillow 4.9/100: 5% pain defensive_spikes, demon_spikes
0:48.057 immolation_aura Fluffy_Pillow 8.1/100: 8% pain defensive_spikes, demon_spikes
0:49.430 shear Fluffy_Pillow 18.1/100: 18% pain defensive_spikes, demon_spikes, immolation_aura
0:50.862 Waiting 1.900 sec 31.1/100: 31% pain raid_movement, demon_spikes, immolation_aura
0:52.762 auto_attack Fluffy_Pillow 36.0/100: 36% pain demon_spikes, immolation_aura
0:52.762 shear Fluffy_Pillow 36.0/100: 36% pain demon_spikes, immolation_aura
0:54.193 shear Fluffy_Pillow 53.8/100: 54% pain
0:55.624 shear Fluffy_Pillow 63.8/100: 64% pain
0:57.056 shear Fluffy_Pillow 78.0/100: 78% pain
0:58.489 soul_cleave Fluffy_Pillow 91.8/100: 92% pain
0:59.725 demon_spikes Fluffy_Pillow 11.8/100: 12% pain defensive_spikes, demon_spikes
0:59.921 felblade Fluffy_Pillow 11.8/100: 12% pain defensive_spikes, demon_spikes
1:01.351 auto_attack Fluffy_Pillow 32.8/100: 33% pain defensive_spikes, demon_spikes
1:01.351 shear Fluffy_Pillow 32.8/100: 33% pain defensive_spikes, demon_spikes
1:02.782 immolation_aura Fluffy_Pillow 43.7/100: 44% pain demon_spikes
1:04.143 felblade Fluffy_Pillow 54.7/100: 55% pain demon_spikes, immolation_aura
1:05.576 sigil_of_flame Fluffy_Pillow 79.3/100: 79% pain demon_spikes, immolation_aura
1:05.776 fiery_brand Fluffy_Pillow 79.3/100: 79% pain immolation_aura
1:06.938 soul_carver Fluffy_Pillow 85.4/100: 85% pain immolation_aura
1:08.368 soul_cleave Fluffy_Pillow 87.4/100: 87% pain immolation_aura
1:09.798 shear Fluffy_Pillow 29.4/100: 29% pain
1:11.230 infernal_strike Fluffy_Pillow 39.4/100: 39% pain
1:11.230 felblade Fluffy_Pillow 39.4/100: 39% pain
1:12.663 shear Fluffy_Pillow 61.3/100: 61% pain
1:13.863 demon_spikes Fluffy_Pillow 51.3/100: 51% pain defensive_spikes, demon_spikes, blood_frenzy
1:14.095 shear Fluffy_Pillow 51.3/100: 51% pain defensive_spikes, demon_spikes, blood_frenzy
1:15.420 soul_cleave Fluffy_Pillow 61.3/100: 61% pain defensive_spikes, demon_spikes, blood_frenzy
1:16.745 immolation_aura Fluffy_Pillow 1.3/100: 1% pain raid_movement, defensive_spikes, demon_spikes, blood_frenzy
1:17.045 empower_wards Fluffy_Pillow 9.3/100: 9% pain demon_spikes, empower_wards, immolation_aura, blood_frenzy
1:17.914 auto_attack Fluffy_Pillow 11.3/100: 11% pain demon_spikes, empower_wards, immolation_aura, blood_frenzy
1:17.914 shear Fluffy_Pillow 11.3/100: 11% pain demon_spikes, empower_wards, immolation_aura, blood_frenzy
1:19.239 shear Fluffy_Pillow 26.8/100: 27% pain demon_spikes, empower_wards, immolation_aura, blood_frenzy
1:20.565 infernal_strike Fluffy_Pillow 42.0/100: 42% pain raid_movement, empower_wards, immolation_aura, blood_frenzy
1:20.565 auto_attack Fluffy_Pillow 42.0/100: 42% pain empower_wards, immolation_aura, blood_frenzy
1:20.565 shear Fluffy_Pillow 42.0/100: 42% pain empower_wards, immolation_aura, blood_frenzy
1:21.889 shear Fluffy_Pillow 56.0/100: 56% pain empower_wards, immolation_aura, blood_frenzy
1:23.214 demon_spikes Fluffy_Pillow 70.9/100: 71% pain
1:23.318 felblade Fluffy_Pillow 50.9/100: 51% pain defensive_spikes, demon_spikes
1:24.751 shear Fluffy_Pillow 72.8/100: 73% pain defensive_spikes, demon_spikes
1:26.183 soul_cleave Fluffy_Pillow 82.8/100: 83% pain defensive_spikes, demon_spikes
1:27.614 shear Fluffy_Pillow 23.8/100: 24% pain demon_spikes
1:29.047 shear Fluffy_Pillow 34.8/100: 35% pain demon_spikes
1:30.478 immolation_aura Fluffy_Pillow 47.7/100: 48% pain
1:31.903 felblade Fluffy_Pillow 58.6/100: 59% pain immolation_aura
1:33.334 auto_attack Fluffy_Pillow 84.8/100: 85% pain immolation_aura
1:33.334 soul_cleave Fluffy_Pillow 84.8/100: 85% pain immolation_aura
1:34.767 shear Fluffy_Pillow 35.5/100: 35% pain immolation_aura
1:36.199 felblade Fluffy_Pillow 51.4/100: 51% pain immolation_aura
1:36.592 demon_spikes Fluffy_Pillow 53.4/100: 53% pain defensive_spikes, demon_spikes
1:37.631 sigil_of_flame Fluffy_Pillow 54.3/100: 54% pain defensive_spikes, demon_spikes
1:38.991 shear Fluffy_Pillow 56.5/100: 57% pain defensive_spikes, demon_spikes
1:40.423 shear Fluffy_Pillow 69.7/100: 70% pain demon_spikes
1:41.853 soul_cleave Fluffy_Pillow 80.7/100: 81% pain demon_spikes
1:43.284 infernal_strike Fluffy_Pillow 21.7/100: 22% pain
1:43.284 shear Fluffy_Pillow 21.7/100: 22% pain
1:44.715 immolation_aura Fluffy_Pillow 31.7/100: 32% pain blood_frenzy
1:45.943 felblade Fluffy_Pillow 42.6/100: 43% pain immolation_aura, blood_frenzy
1:47.268 shear Fluffy_Pillow 64.6/100: 65% pain immolation_aura, blood_frenzy
1:48.595 Waiting 0.300 sec 79.6/100: 80% pain raid_movement, immolation_aura, blood_frenzy
1:48.895 auto_attack Fluffy_Pillow 81.6/100: 82% pain immolation_aura, blood_frenzy
1:48.895 soul_cleave Fluffy_Pillow 81.6/100: 82% pain immolation_aura, blood_frenzy
1:49.449 demon_spikes Fluffy_Pillow 1.6/100: 2% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
1:50.220 Waiting 3.200 sec 5.7/100: 6% pain raid_movement, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
1:53.420 auto_attack Fluffy_Pillow 9.7/100: 10% pain demon_spikes, blood_frenzy
1:53.420 shear Fluffy_Pillow 9.7/100: 10% pain demon_spikes, blood_frenzy
1:54.120 empower_wards Fluffy_Pillow 21.8/100: 22% pain demon_spikes, empower_wards, blood_frenzy
1:54.744 shear Fluffy_Pillow 21.8/100: 22% pain demon_spikes, empower_wards, blood_frenzy
1:56.069 shear Fluffy_Pillow 36.7/100: 37% pain empower_wards, blood_frenzy
1:57.395 shear Fluffy_Pillow 46.7/100: 47% pain empower_wards
1:58.825 immolation_aura Fluffy_Pillow 59.4/100: 59% pain empower_wards
2:00.187 shear Fluffy_Pillow 72.3/100: 72% pain immolation_aura
2:01.620 soul_cleave Fluffy_Pillow 84.3/100: 84% pain immolation_aura
2:02.134 demon_spikes Fluffy_Pillow 9.2/100: 9% pain defensive_spikes, demon_spikes, immolation_aura
2:03.053 felblade Fluffy_Pillow 13.5/100: 13% pain defensive_spikes, demon_spikes, immolation_aura
2:04.483 Waiting 0.500 sec 37.7/100: 38% pain raid_movement, defensive_spikes, demon_spikes, immolation_aura
2:04.983 auto_attack Fluffy_Pillow 39.7/100: 40% pain defensive_spikes, demon_spikes
2:04.983 shear Fluffy_Pillow 39.7/100: 40% pain defensive_spikes, demon_spikes
2:06.415 shear Fluffy_Pillow 52.0/100: 52% pain demon_spikes
2:07.845 sigil_of_flame Fluffy_Pillow 62.0/100: 62% pain demon_spikes
2:08.145 fiery_brand Fluffy_Pillow 62.9/100: 63% pain
2:09.207 soul_carver Fluffy_Pillow 62.9/100: 63% pain
2:10.639 shear Fluffy_Pillow 65.3/100: 65% pain
2:12.069 soul_cleave Fluffy_Pillow 77.6/100: 78% pain
2:13.502 infernal_strike Fluffy_Pillow 17.6/100: 18% pain
2:13.502 immolation_aura Fluffy_Pillow 17.6/100: 18% pain
2:14.863 felblade Fluffy_Pillow 30.1/100: 30% pain immolation_aura
2:16.163 demon_spikes Fluffy_Pillow 34.7/100: 35% pain defensive_spikes, demon_spikes, immolation_aura
2:16.295 shear Fluffy_Pillow 34.7/100: 35% pain defensive_spikes, demon_spikes, immolation_aura
2:17.724 shear Fluffy_Pillow 48.7/100: 49% pain defensive_spikes, demon_spikes, immolation_aura
2:19.157 shear Fluffy_Pillow 63.6/100: 64% pain defensive_spikes, demon_spikes, immolation_aura
2:20.589 infernal_strike Fluffy_Pillow 78.8/100: 79% pain raid_movement, demon_spikes
2:20.589 auto_attack Fluffy_Pillow 78.8/100: 79% pain demon_spikes
2:20.589 shear Fluffy_Pillow 78.8/100: 79% pain demon_spikes
2:22.021 soul_cleave Fluffy_Pillow 88.8/100: 89% pain demon_spikes
2:23.453 shear Fluffy_Pillow 29.8/100: 30% pain
2:24.681 demon_spikes Fluffy_Pillow 24.1/100: 24% pain defensive_spikes, demon_spikes
2:24.885 shear Fluffy_Pillow 24.1/100: 24% pain defensive_spikes, demon_spikes
2:26.318 shear Fluffy_Pillow 37.0/100: 37% pain defensive_spikes, demon_spikes
2:27.749 immolation_aura Fluffy_Pillow 47.0/100: 47% pain demon_spikes
2:29.110 felblade Fluffy_Pillow 59.2/100: 59% pain demon_spikes, immolation_aura, blood_frenzy
2:30.436 soul_cleave Fluffy_Pillow 83.2/100: 83% pain demon_spikes, immolation_aura, blood_frenzy
2:31.761 shear Fluffy_Pillow 25.2/100: 25% pain immolation_aura, blood_frenzy
2:32.161 empower_wards Fluffy_Pillow 40.8/100: 41% pain empower_wards, immolation_aura, blood_frenzy
2:33.088 shear Fluffy_Pillow 42.8/100: 43% pain empower_wards, immolation_aura, blood_frenzy
2:34.415 shear Fluffy_Pillow 59.4/100: 59% pain empower_wards, blood_frenzy
2:35.739 shear Fluffy_Pillow 69.4/100: 69% pain empower_wards, blood_frenzy
2:36.196 demon_spikes Fluffy_Pillow 59.4/100: 59% pain raid_movement, defensive_spikes, demon_spikes, empower_wards, blood_frenzy
2:37.062 Waiting 0.100 sec 59.4/100: 59% pain raid_movement, defensive_spikes, demon_spikes, empower_wards, blood_frenzy
2:37.162 auto_attack Fluffy_Pillow 59.4/100: 59% pain defensive_spikes, demon_spikes, empower_wards, blood_frenzy
2:37.162 shear Fluffy_Pillow 59.4/100: 59% pain defensive_spikes, demon_spikes, empower_wards, blood_frenzy
2:38.487 sigil_of_flame Fluffy_Pillow 71.3/100: 71% pain defensive_spikes, demon_spikes, blood_frenzy
2:39.725 shear Fluffy_Pillow 71.3/100: 71% pain demon_spikes
2:41.156 soul_cleave Fluffy_Pillow 83.2/100: 83% pain demon_spikes
2:42.587 immolation_aura Fluffy_Pillow 25.2/100: 25% pain
2:43.949 infernal_strike Fluffy_Pillow 35.2/100: 35% pain immolation_aura
2:43.949 felblade Fluffy_Pillow 35.2/100: 35% pain immolation_aura
2:45.379 shear Fluffy_Pillow 60.6/100: 61% pain immolation_aura
2:46.810 shear Fluffy_Pillow 78.0/100: 78% pain immolation_aura
2:48.242 soul_cleave Fluffy_Pillow 90.0/100: 90% pain immolation_aura
2:48.261 demon_spikes Fluffy_Pillow 10.0/100: 10% pain defensive_spikes, demon_spikes, immolation_aura
2:49.674 shear Fluffy_Pillow 12.9/100: 13% pain defensive_spikes, demon_spikes
2:51.105 Waiting 1.600 sec 23.9/100: 24% pain raid_movement, defensive_spikes, demon_spikes
2:52.705 auto_attack Fluffy_Pillow 25.8/100: 26% pain demon_spikes
2:52.705 shear Fluffy_Pillow 25.8/100: 26% pain demon_spikes
2:54.136 shear Fluffy_Pillow 39.0/100: 39% pain demon_spikes
2:55.568 shear Fluffy_Pillow 50.0/100: 50% pain
2:56.999 immolation_aura Fluffy_Pillow 63.1/100: 63% pain
2:58.359 shear Fluffy_Pillow 77.2/100: 77% pain immolation_aura
2:59.790 infernal_strike Fluffy_Pillow 90.2/100: 90% pain immolation_aura
3:00.001 soul_cleave Fluffy_Pillow 95.5/100: 95% pain immolation_aura
3:01.430 demon_spikes Fluffy_Pillow 42.3/100: 42% pain immolation_aura
3:01.535 felblade Fluffy_Pillow 22.3/100: 22% pain defensive_spikes, demon_spikes, immolation_aura
3:02.969 shear Fluffy_Pillow 46.3/100: 46% pain defensive_spikes, demon_spikes, immolation_aura
3:04.402 shear Fluffy_Pillow 61.3/100: 61% pain defensive_spikes, demon_spikes
3:05.834 shear Fluffy_Pillow 72.2/100: 72% pain demon_spikes
3:07.265 soul_cleave Fluffy_Pillow 85.4/100: 85% pain demon_spikes
3:08.698 fiery_brand Fluffy_Pillow 28.8/100: 29% pain raid_movement, blood_frenzy
3:08.698 sigil_of_flame Fluffy_Pillow 28.8/100: 29% pain raid_movement, blood_frenzy
3:09.098 empower_wards Fluffy_Pillow 28.8/100: 29% pain raid_movement, empower_wards, blood_frenzy
3:09.866 auto_attack Fluffy_Pillow 28.8/100: 29% pain empower_wards, blood_frenzy
3:09.866 soul_carver Fluffy_Pillow 28.8/100: 29% pain empower_wards, blood_frenzy
3:11.193 immolation_aura Fluffy_Pillow 31.4/100: 31% pain empower_wards, blood_frenzy
3:12.361 shear Fluffy_Pillow 43.1/100: 43% pain empower_wards, immolation_aura, blood_frenzy
3:13.687 felblade Fluffy_Pillow 55.1/100: 55% pain empower_wards, immolation_aura, blood_frenzy
3:15.014 soul_cleave Fluffy_Pillow 77.1/100: 77% pain empower_wards, immolation_aura, blood_frenzy
3:16.339 shear Fluffy_Pillow 23.2/100: 23% pain immolation_aura, blood_frenzy
3:16.739 demon_spikes Fluffy_Pillow 13.2/100: 13% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
3:17.665 shear Fluffy_Pillow 15.2/100: 15% pain defensive_spikes, demon_spikes, blood_frenzy
3:18.991 shear Fluffy_Pillow 25.2/100: 25% pain defensive_spikes, demon_spikes, blood_frenzy
3:20.316 infernal_strike Fluffy_Pillow 35.2/100: 35% pain raid_movement, demon_spikes, blood_frenzy
3:20.316 auto_attack Fluffy_Pillow 35.2/100: 35% pain demon_spikes, blood_frenzy
3:20.316 shear Fluffy_Pillow 35.2/100: 35% pain demon_spikes, blood_frenzy
3:21.641 shear Fluffy_Pillow 45.2/100: 45% pain demon_spikes, blood_frenzy
3:22.966 shear Fluffy_Pillow 57.1/100: 57% pain blood_frenzy
3:24.292 demon_spikes Fluffy_Pillow 70.1/100: 70% pain raid_movement, blood_frenzy
3:24.480 immolation_aura Fluffy_Pillow 50.1/100: 50% pain raid_movement, defensive_spikes, demon_spikes, blood_frenzy
3:25.648 auto_attack Fluffy_Pillow 60.1/100: 60% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
3:25.648 shear Fluffy_Pillow 60.1/100: 60% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
3:26.975 shear Fluffy_Pillow 74.0/100: 74% pain defensive_spikes, demon_spikes, immolation_aura
3:28.406 soul_cleave Fluffy_Pillow 86.0/100: 86% pain demon_spikes, immolation_aura
3:29.836 felblade Fluffy_Pillow 30.0/100: 30% pain demon_spikes, immolation_aura, blood_frenzy
3:31.162 shear Fluffy_Pillow 57.6/100: 58% pain blood_frenzy
3:32.486 felblade Fluffy_Pillow 68.6/100: 69% pain blood_frenzy
3:33.810 soul_cleave Fluffy_Pillow 88.6/100: 89% pain blood_frenzy
3:33.855 demon_spikes Fluffy_Pillow 8.6/100: 9% pain defensive_spikes, demon_spikes, blood_frenzy
3:35.136 shear Fluffy_Pillow 11.4/100: 11% pain defensive_spikes, demon_spikes, blood_frenzy
3:36.461 shear Fluffy_Pillow 22.4/100: 22% pain defensive_spikes, demon_spikes, blood_frenzy
3:37.788 immolation_aura Fluffy_Pillow 32.4/100: 32% pain demon_spikes, blood_frenzy
3:39.024 sigil_of_flame Fluffy_Pillow 45.4/100: 45% pain demon_spikes, immolation_aura, blood_frenzy
3:40.192 Waiting 0.700 sec 51.7/100: 52% pain raid_movement, immolation_aura, blood_frenzy
3:40.892 auto_attack Fluffy_Pillow 53.7/100: 54% pain immolation_aura, blood_frenzy
3:40.892 shear Fluffy_Pillow 53.7/100: 54% pain immolation_aura, blood_frenzy
3:42.217 shear Fluffy_Pillow 69.8/100: 70% pain immolation_aura, blood_frenzy
3:43.542 soul_cleave Fluffy_Pillow 81.8/100: 82% pain immolation_aura, blood_frenzy
3:44.869 infernal_strike Fluffy_Pillow 27.6/100: 28% pain blood_frenzy
3:44.869 shear Fluffy_Pillow 27.6/100: 28% pain blood_frenzy
3:46.068 demon_spikes Fluffy_Pillow 20.7/100: 21% pain defensive_spikes, demon_spikes, blood_frenzy
3:46.168 empower_wards Fluffy_Pillow 21.7/100: 22% pain defensive_spikes, demon_spikes, empower_wards, blood_frenzy
3:46.196 felblade Fluffy_Pillow 21.7/100: 22% pain defensive_spikes, demon_spikes, empower_wards, blood_frenzy
3:47.521 shear Fluffy_Pillow 41.7/100: 42% pain defensive_spikes, demon_spikes, empower_wards, blood_frenzy
3:48.847 shear Fluffy_Pillow 56.1/100: 56% pain defensive_spikes, demon_spikes, empower_wards, blood_frenzy
3:50.173 Waiting 0.700 sec 68.2/100: 68% pain raid_movement, demon_spikes, empower_wards, blood_frenzy
3:50.873 immolation_aura Fluffy_Pillow 68.2/100: 68% pain raid_movement, demon_spikes, empower_wards, blood_frenzy
3:52.237 Waiting 0.800 sec 80.0/100: 80% pain raid_movement, immolation_aura
3:53.037 auto_attack Fluffy_Pillow 80.0/100: 80% pain immolation_aura
3:53.037 shear Fluffy_Pillow 80.0/100: 80% pain immolation_aura
3:54.469 soul_cleave Fluffy_Pillow 97.3/100: 97% pain immolation_aura, blood_frenzy
3:55.795 shear Fluffy_Pillow 39.3/100: 39% pain immolation_aura, blood_frenzy
3:57.120 auto_attack Fluffy_Pillow 56.4/100: 56% pain blood_frenzy
3:57.120 shear Fluffy_Pillow 56.4/100: 56% pain blood_frenzy
3:58.339 demon_spikes Fluffy_Pillow 49.3/100: 49% pain defensive_spikes, demon_spikes, blood_frenzy
3:58.448 shear Fluffy_Pillow 49.3/100: 49% pain defensive_spikes, demon_spikes, blood_frenzy
3:59.774 infernal_strike Fluffy_Pillow 61.8/100: 62% pain defensive_spikes, demon_spikes, blood_frenzy
4:00.001 felblade Fluffy_Pillow 61.8/100: 62% pain defensive_spikes, demon_spikes, blood_frenzy
4:01.326 soul_cleave Fluffy_Pillow 81.8/100: 82% pain defensive_spikes, demon_spikes, blood_frenzy
4:02.651 shear Fluffy_Pillow 21.8/100: 22% pain demon_spikes, blood_frenzy
4:03.977 shear Fluffy_Pillow 31.8/100: 32% pain demon_spikes
4:05.411 immolation_aura Fluffy_Pillow 44.0/100: 44% pain
4:06.774 felblade Fluffy_Pillow 56.8/100: 57% pain immolation_aura
4:08.174 empower_wards Fluffy_Pillow 82.1/100: 82% pain empower_wards, immolation_aura, blood_frenzy
4:08.206 soul_cleave Fluffy_Pillow 82.1/100: 82% pain empower_wards, immolation_aura, blood_frenzy
4:08.698 fiery_brand Fluffy_Pillow 24.1/100: 24% pain empower_wards, immolation_aura, blood_frenzy
4:09.532 soul_carver Fluffy_Pillow 26.1/100: 26% pain empower_wards, immolation_aura, blood_frenzy
4:10.857 sigil_of_flame Fluffy_Pillow 30.1/100: 30% pain empower_wards, immolation_aura, blood_frenzy
4:12.025 Waiting 1.200 sec 34.4/100: 34% pain raid_movement, empower_wards, blood_frenzy
4:13.225 auto_attack Fluffy_Pillow 34.8/100: 35% pain empower_wards, blood_frenzy
4:13.225 soul_cleave Fluffy_Pillow 34.8/100: 35% pain empower_wards, blood_frenzy
4:14.549 shear Fluffy_Pillow 2.0/100: 2% pain blood_frenzy
4:15.876 felblade Fluffy_Pillow 12.6/100: 13% pain blood_frenzy
4:16.776 demon_spikes Fluffy_Pillow 12.6/100: 13% pain defensive_spikes, demon_spikes
4:17.201 shear Fluffy_Pillow 13.5/100: 14% pain defensive_spikes, demon_spikes
4:18.633 immolation_aura Fluffy_Pillow 23.5/100: 24% pain defensive_spikes, demon_spikes
4:20.241 infernal_strike Fluffy_Pillow 34.5/100: 34% pain raid_movement, demon_spikes, immolation_aura
4:20.241 auto_attack Fluffy_Pillow 34.5/100: 34% pain demon_spikes, immolation_aura
4:20.241 shear Fluffy_Pillow 34.5/100: 34% pain demon_spikes, immolation_aura
4:21.674 shear Fluffy_Pillow 47.5/100: 47% pain demon_spikes, immolation_aura
4:22.874 demon_spikes Fluffy_Pillow 41.4/100: 41% pain defensive_spikes, demon_spikes, immolation_aura
4:23.107 shear Fluffy_Pillow 44.4/100: 44% pain defensive_spikes, demon_spikes, immolation_aura
4:24.538 shear Fluffy_Pillow 58.4/100: 58% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
4:25.864 shear Fluffy_Pillow 73.6/100: 74% pain defensive_spikes, demon_spikes, blood_frenzy
4:27.188 soul_cleave Fluffy_Pillow 86.8/100: 87% pain demon_spikes, blood_frenzy
4:28.514 Waiting 0.700 sec 28.9/100: 29% pain raid_movement, demon_spikes, blood_frenzy
4:29.214 auto_attack Fluffy_Pillow 29.9/100: 30% pain blood_frenzy
4:29.214 shear Fluffy_Pillow 29.9/100: 30% pain blood_frenzy
4:30.539 felblade Fluffy_Pillow 42.8/100: 43% pain blood_frenzy
4:31.537 demon_spikes Fluffy_Pillow 42.8/100: 43% pain defensive_spikes, demon_spikes, blood_frenzy
4:31.863 shear Fluffy_Pillow 42.8/100: 43% pain defensive_spikes, demon_spikes, blood_frenzy
4:33.189 immolation_aura Fluffy_Pillow 54.7/100: 55% pain defensive_spikes, demon_spikes, blood_frenzy
4:34.356 felblade Fluffy_Pillow 64.7/100: 65% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
4:35.682 soul_cleave Fluffy_Pillow 86.7/100: 87% pain demon_spikes, immolation_aura, blood_frenzy
4:37.008 shear Fluffy_Pillow 28.7/100: 29% pain demon_spikes, immolation_aura, blood_frenzy
4:38.332 shear Fluffy_Pillow 45.8/100: 46% pain immolation_aura, blood_frenzy
4:39.657 shear Fluffy_Pillow 57.8/100: 58% pain blood_frenzy
4:40.982 sigil_of_flame Fluffy_Pillow 67.8/100: 68% pain
4:42.344 shear Fluffy_Pillow 70.9/100: 71% pain
4:43.775 demon_spikes Fluffy_Pillow 80.9/100: 81% pain
4:44.000 demon_spikes Fluffy_Pillow 80.9/100: 81% pain raid_movement
4:44.006 Waiting 1.200 sec 60.9/100: 61% pain raid_movement, defensive_spikes, demon_spikes
4:45.206 auto_attack Fluffy_Pillow 60.9/100: 61% pain defensive_spikes, demon_spikes
4:45.206 shear Fluffy_Pillow 60.9/100: 61% pain defensive_spikes, demon_spikes
4:46.638 infernal_strike Fluffy_Pillow 70.9/100: 71% pain defensive_spikes, demon_spikes
4:46.638 immolation_aura Fluffy_Pillow 70.9/100: 71% pain defensive_spikes, demon_spikes
4:48.232 soul_cleave Fluffy_Pillow 82.8/100: 83% pain demon_spikes, immolation_aura
4:49.132 empower_wards Fluffy_Pillow 24.8/100: 25% pain demon_spikes, empower_wards, immolation_aura, blood_frenzy
4:49.663 felblade Fluffy_Pillow 24.8/100: 25% pain demon_spikes, empower_wards, immolation_aura, blood_frenzy
4:50.988 Waiting 1.800 sec 50.8/100: 51% pain raid_movement, empower_wards, immolation_aura, blood_frenzy
4:52.788 auto_attack Fluffy_Pillow 56.4/100: 56% pain empower_wards, immolation_aura, blood_frenzy
4:52.788 shear Fluffy_Pillow 56.4/100: 56% pain empower_wards, immolation_aura, blood_frenzy
4:54.112 shear Fluffy_Pillow 71.5/100: 72% pain empower_wards, blood_frenzy
4:55.438 soul_cleave Fluffy_Pillow 82.2/100: 82% pain blood_frenzy
4:55.653 demon_spikes Fluffy_Pillow 2.2/100: 2% pain defensive_spikes, demon_spikes, blood_frenzy
4:56.765 felblade Fluffy_Pillow 5.2/100: 5% pain defensive_spikes, demon_spikes, blood_frenzy
4:58.090 shear Fluffy_Pillow 27.5/100: 28% pain defensive_spikes, demon_spikes, blood_frenzy
4:59.414 felblade Fluffy_Pillow 38.5/100: 38% pain demon_spikes
5:00.844 immolation_aura Fluffy_Pillow 61.4/100: 61% pain raid_movement, demon_spikes
5:02.205 auto_attack Fluffy_Pillow 77.8/100: 78% pain immolation_aura
5:02.205 shear Fluffy_Pillow 77.8/100: 78% pain immolation_aura
5:03.636 soul_cleave Fluffy_Pillow 89.8/100: 90% pain immolation_aura
5:05.067 felblade Fluffy_Pillow 37.8/100: 38% pain immolation_aura
5:06.499 shear Fluffy_Pillow 63.9/100: 64% pain immolation_aura
5:07.930 shear Fluffy_Pillow 75.9/100: 76% pain
5:08.667 demon_spikes Fluffy_Pillow 70.2/100: 70% pain defensive_spikes, demon_spikes
5:09.360 shear Fluffy_Pillow 70.2/100: 70% pain defensive_spikes, demon_spikes
5:10.791 sigil_of_flame Fluffy_Pillow 81.2/100: 81% pain defensive_spikes, demon_spikes
5:12.253 soul_cleave Fluffy_Pillow 81.2/100: 81% pain demon_spikes, blood_frenzy
5:13.577 felblade Fluffy_Pillow 21.2/100: 21% pain demon_spikes, blood_frenzy
5:14.677 fiery_brand Fluffy_Pillow 41.2/100: 41% pain blood_frenzy
5:14.902 soul_carver Fluffy_Pillow 41.2/100: 41% pain blood_frenzy
5:16.226 infernal_strike Fluffy_Pillow 41.2/100: 41% pain raid_movement, blood_frenzy
5:16.226 auto_attack Fluffy_Pillow 41.2/100: 41% pain blood_frenzy
5:16.226 immolation_aura Fluffy_Pillow 41.2/100: 41% pain blood_frenzy
5:17.394 shear Fluffy_Pillow 51.2/100: 51% pain immolation_aura, blood_frenzy
5:18.718 felblade Fluffy_Pillow 65.0/100: 65% pain immolation_aura, blood_frenzy
5:20.043 infernal_strike Fluffy_Pillow 88.8/100: 89% pain immolation_aura, blood_frenzy
5:20.043 soul_cleave Fluffy_Pillow 88.8/100: 89% pain immolation_aura, blood_frenzy
5:21.370 shear Fluffy_Pillow 32.8/100: 33% pain immolation_aura
5:22.770 demon_spikes Fluffy_Pillow 24.8/100: 25% pain defensive_spikes, demon_spikes
5:22.803 shear Fluffy_Pillow 24.8/100: 25% pain defensive_spikes, demon_spikes
5:24.236 shear Fluffy_Pillow 34.8/100: 35% pain defensive_spikes, demon_spikes
5:25.668 felblade Fluffy_Pillow 44.8/100: 45% pain defensive_spikes, demon_spikes
5:27.099 shear Fluffy_Pillow 69.2/100: 69% pain demon_spikes
5:28.531 soul_cleave Fluffy_Pillow 81.2/100: 81% pain demon_spikes
5:29.273 demon_spikes Fluffy_Pillow 1.2/100: 1% pain defensive_spikes, demon_spikes
5:29.963 immolation_aura Fluffy_Pillow 1.2/100: 1% pain defensive_spikes, demon_spikes
5:30.206 empower_wards Fluffy_Pillow 9.2/100: 9% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura, blood_frenzy
5:31.365 shear Fluffy_Pillow 11.2/100: 11% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura, blood_frenzy
5:32.690 Waiting 0.200 sec 23.2/100: 23% pain raid_movement, demon_spikes, empower_wards, immolation_aura, blood_frenzy
5:32.890 auto_attack Fluffy_Pillow 23.2/100: 23% pain demon_spikes, empower_wards, immolation_aura, blood_frenzy
5:32.890 shear Fluffy_Pillow 23.2/100: 23% pain demon_spikes, empower_wards, immolation_aura, blood_frenzy
5:34.218 shear Fluffy_Pillow 39.8/100: 40% pain demon_spikes, empower_wards, immolation_aura, blood_frenzy
5:35.545 shear Fluffy_Pillow 52.4/100: 52% pain empower_wards, immolation_aura, blood_frenzy
5:36.869 shear Fluffy_Pillow 67.5/100: 68% pain blood_frenzy
5:38.195 soul_cleave Fluffy_Pillow 81.6/100: 82% pain blood_frenzy
5:39.520 felblade Fluffy_Pillow 24.7/100: 25% pain blood_frenzy
5:40.845 sigil_of_flame Fluffy_Pillow 44.7/100: 45% pain
5:41.660 demon_spikes Fluffy_Pillow 25.7/100: 26% pain defensive_spikes, demon_spikes
5:42.343 shear Fluffy_Pillow 27.5/100: 28% pain defensive_spikes, demon_spikes
5:43.775 immolation_aura Fluffy_Pillow 38.5/100: 39% pain defensive_spikes, demon_spikes
5:45.137 felblade Fluffy_Pillow 49.5/100: 49% pain demon_spikes, immolation_aura
5:46.569 infernal_strike Fluffy_Pillow 73.5/100: 74% pain demon_spikes, immolation_aura
5:46.569 shear Fluffy_Pillow 73.5/100: 74% pain demon_spikes, immolation_aura
5:48.000 Waiting 0.900 sec 91.6/100: 92% pain raid_movement, immolation_aura
5:48.900 auto_attack Fluffy_Pillow 93.6/100: 94% pain immolation_aura
5:48.900 soul_cleave Fluffy_Pillow 93.6/100: 94% pain immolation_aura
5:50.333 shear Fluffy_Pillow 36.6/100: 37% pain
5:51.765 shear Fluffy_Pillow 47.5/100: 48% pain
5:53.195 shear Fluffy_Pillow 60.6/100: 61% pain
5:54.625 shear Fluffy_Pillow 73.9/100: 74% pain
5:55.835 demon_spikes Fluffy_Pillow 67.8/100: 68% pain defensive_spikes, demon_spikes, blood_frenzy
5:56.056 shear Fluffy_Pillow 69.9/100: 70% pain defensive_spikes, demon_spikes, blood_frenzy
5:57.382 shear Fluffy_Pillow 79.9/100: 80% pain defensive_spikes, demon_spikes, blood_frenzy
5:58.707 soul_cleave Fluffy_Pillow 91.9/100: 92% pain defensive_spikes, demon_spikes, blood_frenzy
6:00.032 immolation_aura Fluffy_Pillow 33.8/100: 34% pain demon_spikes, blood_frenzy
6:01.200 infernal_strike Fluffy_Pillow 43.8/100: 44% pain demon_spikes, immolation_aura, blood_frenzy
6:01.200 felblade Fluffy_Pillow 43.8/100: 44% pain demon_spikes, immolation_aura, blood_frenzy
6:02.526 shear Fluffy_Pillow 68.6/100: 69% pain immolation_aura, blood_frenzy
6:03.853 soul_cleave Fluffy_Pillow 80.6/100: 81% pain immolation_aura, blood_frenzy
6:05.179 auto_attack Fluffy_Pillow 28.0/100: 28% pain immolation_aura, blood_frenzy
6:05.179 shear Fluffy_Pillow 28.0/100: 28% pain immolation_aura, blood_frenzy
6:06.503 felblade Fluffy_Pillow 43.0/100: 43% pain blood_frenzy
6:07.048 demon_spikes Fluffy_Pillow 43.0/100: 43% pain defensive_spikes, demon_spikes, blood_frenzy
6:07.828 shear Fluffy_Pillow 43.0/100: 43% pain defensive_spikes, demon_spikes, blood_frenzy
6:09.154 shear Fluffy_Pillow 55.1/100: 55% pain defensive_spikes, demon_spikes, blood_frenzy
6:10.479 shear Fluffy_Pillow 67.3/100: 67% pain demon_spikes, blood_frenzy
6:11.179 empower_wards Fluffy_Pillow 77.3/100: 77% pain demon_spikes, empower_wards, blood_frenzy
6:11.803 sigil_of_flame Fluffy_Pillow 77.3/100: 77% pain demon_spikes, empower_wards, blood_frenzy
6:13.045 shear Fluffy_Pillow 77.3/100: 77% pain demon_spikes, empower_wards
6:14.477 fiery_brand Fluffy_Pillow 91.0/100: 91% pain empower_wards
6:14.677 soul_carver Fluffy_Pillow 91.0/100: 91% pain empower_wards
6:16.106 soul_cleave Fluffy_Pillow 92.9/100: 93% pain empower_wards
6:17.538 immolation_aura Fluffy_Pillow 34.3/100: 34% pain
6:18.899 shear Fluffy_Pillow 46.7/100: 47% pain immolation_aura
6:20.329 infernal_strike Fluffy_Pillow 61.1/100: 61% pain raid_movement, immolation_aura
6:20.329 auto_attack Fluffy_Pillow 61.1/100: 61% pain immolation_aura
6:20.329 felblade Fluffy_Pillow 61.1/100: 61% pain immolation_aura
6:21.764 soul_cleave Fluffy_Pillow 85.1/100: 85% pain immolation_aura
6:22.764 demon_spikes Fluffy_Pillow 9.6/100: 10% pain defensive_spikes, demon_spikes, immolation_aura
6:23.194 shear Fluffy_Pillow 9.6/100: 10% pain defensive_spikes, demon_spikes, immolation_aura
6:24.626 shear Fluffy_Pillow 27.2/100: 27% pain defensive_spikes, demon_spikes
6:26.058 shear Fluffy_Pillow 37.2/100: 37% pain demon_spikes
6:27.489 shear Fluffy_Pillow 48.2/100: 48% pain demon_spikes
6:28.920 shear Fluffy_Pillow 61.4/100: 61% pain
6:30.193 demon_spikes Fluffy_Pillow 55.6/100: 56% pain defensive_spikes, demon_spikes
6:30.352 felblade Fluffy_Pillow 55.6/100: 56% pain defensive_spikes, demon_spikes
6:31.785 immolation_aura Fluffy_Pillow 75.6/100: 76% pain defensive_spikes, demon_spikes

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8803 8478 0
Agility 24145 22520 13488 (9544)
Stamina 46683 46683 19893
Intellect 5328 5003 0
Spirit 2 2 0
Health 2913019 2913019 0
Pain 100 100 0
Crit 42.89% 41.82% 9036
Haste 5.09% 5.09% 1655
Damage / Heal Versatility 8.32% 8.32% 3328
Mitigation Versatility 4.16% 4.16% 3328
Attack Power 28522 26603 0
Mastery 13.60% 13.60% 3547
Armor 4492 4492 2042
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 14.52% 13.70% 0
Tank-Parry 15.15% 14.85% 9036
Tank-Block 0.00% 0.00% 0
Tank-Crit -6.00% -6.00% 0

Gear

Source Slot Average Item Level: 856.00
Local Head Biornskin Hood
ilevel: 865, stats: { 281 Armor, +1491 AgiInt, +2237 Sta, +809 Crit, +571 Mastery }
Local Neck Blackened Portalstone Necklace
ilevel: 860, stats: { +1201 Sta, +1252 Crit, +653 Haste }
Local Shoulders Otherworldy Leather Mantle
ilevel: 850, stats: { 247 Armor, +1459 Sta, +973 AgiInt, +594 Crit, +385 Mastery }
Local Chest Grove Keeper's Robe
ilevel: 850, stats: { 329 Armor, +1945 Sta, +1297 AgiInt, +904 Crit, +400 Haste }
Local Waist Steelgazer Hide Belt
ilevel: 835, stats: { 176 Armor, +846 AgiInt, +1269 Sta, +602 Haste, +324 Vers }
Local Legs Splotched Bloodfur Leggings
ilevel: 850, stats: { 288 Armor, +1945 Sta, +1297 AgiInt, +932 Crit, +372 Mastery }
Local Feet Dreadleather Footpads of the Quickblade
ilevel: 850, stats: { 226 Armor, +1459 Sta, +973 AgiInt, +490 Crit, +490 Vers }
Local Wrists Wristwraps of Broken Trust
ilevel: 850, stats: { 144 Armor, +1094 Sta, +729 AgiInt, +445 Mastery, +288 Crit }
Local Hands Dreadleather Gloves of the Quickblade
ilevel: 850, stats: { 206 Armor, +1459 Sta, +973 AgiInt, +279 Crit, +699 Vers }
Local Finger1 Dingy Suramar Mercantile Signet
ilevel: 865, stats: { +1258 Sta, +1387 Crit, +555 Vers }, enchant: { +150 Vers }
Local Finger2 Ring of Deep Sea Pearls
ilevel: 860, stats: { +1201 Sta, +1198 Mastery, +708 Vers }, enchant: { +150 Vers }
Local Trinket1 An'she's Token of Guile
ilevel: 850, stats: { +1233 Agi, +932 Crit }
Local Trinket2 Bloodthirsty Instinct
ilevel: 850, stats: { +1233 Agi }
Local Back Drape of the Mana-Starved
ilevel: 880, stats: { 145 Armor, +1448 Sta, +965 StrAgiInt, +569 Crit, +252 Vers }, enchant: { +200 Agi }
Local Main Hand Aldrachi Warblades
ilevel: 865, weapon: { 3789 - 7038, 2.6 }, stats: { +639 Agi, +959 Sta, +300 Crit, +288 Mastery }, relics: { +39 ilevels, +40 ilevels, +36 ilevels }
Local Off Hand Aldrachi Warblades
ilevel: 865, weapon: { 3789 - 7038, 2.6 }, stats: { +639 Agi, +959 Sta, +300 Crit, +288 Mastery }

Talents

Level
15 Abyssal Strike (Vengeance Demon Hunter) Agonizing Flames (Vengeance Demon Hunter) Razor Spikes (Vengeance Demon Hunter)
30 Feast of Souls (Vengeance Demon Hunter) Fallout (Vengeance Demon Hunter) Burning Alive (Vengeance Demon Hunter)
45 Felblade Flame Crash (Vengeance Demon Hunter) Fel Eruption (Vengeance Demon Hunter)
60 Feed the Demon (Vengeance Demon Hunter) Fracture (Vengeance Demon Hunter) Soul Rending (Vengeance Demon Hunter)
75 Concentrated Sigils (Vengeance Demon Hunter) Sigil of Chains (Vengeance Demon Hunter) Quickened Sigils (Vengeance Demon Hunter)
90 Fel Devastation (Vengeance Demon Hunter) Blade Turning (Vengeance Demon Hunter) Spirit Bomb (Vengeance Demon Hunter)
100 Last Resort (Vengeance Demon Hunter) Nether Bond (Vengeance Demon Hunter) Soul Barrier (Vengeance Demon Hunter)

Profile

demonhunter="Illistan"
origin="https://us.api.battle.net/wow/character/thrall/Illistan/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/238/157220590-avatar.jpg"
level=110
race=blood_elf
role=tank
position=front
professions=enchanting=59/herbalism=339
talents=2111111
artifact=60:0:0:0:0:1096:1:1101:3:1228:1:1229:3:1232:3:1233:3:1234:3:1328:1
spec=vengeance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=unbending_potion

# Executed every time the actor is available.
actions=auto_attack
actions+=/fiery_brand,if=buff.demon_spikes.down&buff.metamorphosis.down
actions+=/demon_spikes,if=charges=2|buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down
actions+=/empower_wards,if=debuff.casting.up
actions+=/infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&artifact.fiery_demise.enabled&dot.fiery_brand.ticking
actions+=/infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&(!artifact.fiery_demise.enabled|(max_charges-charges_fractional)*recharge_time<cooldown.fiery_brand.remains+5)&(cooldown.sigil_of_flame.remains>7|charges=2)
actions+=/spirit_bomb,if=debuff.frailty.down
actions+=/soul_carver,if=dot.fiery_brand.ticking
actions+=/immolation_aura,if=pain<=80
actions+=/felblade,if=pain<=70
actions+=/soul_barrier
actions+=/soul_cleave,if=soul_fragments=5
actions+=/metamorphosis,if=buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down&incoming_damage_5s>health.max*0.70
actions+=/fel_devastation,if=incoming_damage_5s>health.max*0.70
actions+=/soul_cleave,if=incoming_damage_5s>=health.max*0.70
actions+=/fel_eruption
actions+=/sigil_of_flame,if=remains-delay<=0.3*duration
actions+=/fracture,if=pain>=80&soul_fragments<4&incoming_damage_4s<=health.max*0.20
actions+=/soul_cleave,if=pain>=80
actions+=/shear

head=biornskin_hood,id=134196,bonus_id=1727/1527/3337
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/1482/3336
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1807/1472
back=drape_of_the_manastarved,id=141543,bonus_id=1492/3337,enchant=200agi
chest=grove_keepers_robe,id=139207,bonus_id=1807/1808/1472
wrists=wristwraps_of_broken_trust,id=139209,bonus_id=1807/1472
hands=dreadleather_gloves,id=128886,bonus_id=689/1682/3408/601/669
waist=steelgazer_hide_belt,id=134155,bonus_id=3432/1497/1674
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1807/1472
feet=dreadleather_footpads,id=128885,bonus_id=689/1679/3408/600/669
finger1=dingy_suramar_mercantile_signet,id=141492,bonus_id=1808/1477/3336,enchant=150vers
finger2=ring_of_deep_sea_pearls,id=141545,bonus_id=1472,enchant=150vers
trinket1=anshes_token_of_guile,id=139113,bonus_id=3397/603/1512/3337
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1472
main_hand=aldrachi_warblades,id=128832,bonus_id=721,gem_id=141262/137303/142058/0,relic_id=3432:1497:1674/1727:1492:1813/0/0
off_hand=aldrachi_warblades,id=128831

# Gear Summary
# gear_ilvl=855.94
# gear_agility=13488
# gear_stamina=19893
# gear_crit_rating=9036
# gear_haste_rating=1655
# gear_mastery_rating=3547
# gear_versatility_rating=3328
# gear_armor=2042

Oinkie

Oinkie : 268434 dps, 170021 dps to main target

  • Race: Tauren
  • Class: Druid
  • Spec: Feral
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
268433.5 268433.5 217.0 / 0.081% 43159.0 / 16.1% 18298.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.6 14.6 Energy 18.15% 43.5 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Oinkie/advanced
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Balance Affinity
  • 60: Mighty Bash
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact
Professions
  • herbalism: 815
  • inscription: 714
Scale Factors for Oinkie Damage Per Second
Agi Haste Vers Crit Mastery
Scale Factors 9.03 7.18 6.49 6.11 3.95
Normalized 1.00 0.79 0.72 0.68 0.44
Scale Deltas 1138 1138 1138 1138 1138
Error 0.28 0.27 0.27 0.27 0.27
Gear Ranking
Optimizers
Ranking
  • Agi > Haste > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=9.03, CritRating=6.11, HasteRating=7.18, MasteryRating=3.95, Versatility=6.49 )

Scale Factors for other metrics

Scale Factors for Oinkie Damage Per Second
Agi Haste Vers Crit Mastery
Scale Factors 9.03 7.18 6.49 6.11 3.95
Normalized 1.00 0.79 0.72 0.68 0.44
Scale Deltas 1138 1138 1138 1138 1138
Error 0.28 0.27 0.27 0.27 0.27
Gear Ranking
Optimizers
Ranking
  • Agi > Haste > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=9.03, CritRating=6.11, HasteRating=7.18, MasteryRating=3.95, Versatility=6.49 )
Scale Factors for Oinkie Priority Target Damage Per Second
Agi Haste Vers Crit Mastery
Scale Factors 5.74 4.61 4.07 3.88 2.84
Normalized 1.00 0.80 0.71 0.68 0.49
Scale Deltas 1138 1138 1138 1138 1138
Error 0.29 0.28 0.28 0.28 0.28
Gear Ranking
Optimizers
Ranking
  • Agi > Haste > Vers ~= Crit > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=5.74, CritRating=3.88, HasteRating=4.61, MasteryRating=2.84, Versatility=4.07 )
Scale Factors for Oinkie Damage Per Second (Effective)
Agi Haste Vers Crit Mastery
Scale Factors 9.03 7.18 6.49 6.11 3.95
Normalized 1.00 0.79 0.72 0.68 0.44
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Haste > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=9.03, CritRating=6.11, HasteRating=7.18, MasteryRating=3.95, Versatility=6.49 )
Scale Factors for Oinkie Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for OinkieTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Oinkie 268434
Ashamane's Rip 8210 3.1% 5.7 58.57sec 594050 0 Periodic 44.0 53924 109954 76670 40.6% 14.1%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.68 0.00 44.05 44.05 0.0000 1.2806 3377154.26 3377154.26 0.00 59873.31 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.2 59.40% 53923.88 37 65985 52927.06 0 65985 1410974 1410974 0.00
crit 17.9 40.60% 109953.94 76 134610 107739.10 0 134610 1966181 1966181 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 27897 10.4% 419.6 0.95sec 26660 31491 Direct 419.6 18766 38277 26660 40.5%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 419.57 419.57 0.00 0.00 0.8466 0.0000 11185493.20 16008733.45 30.13 31490.51 31490.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 249.81 59.54% 18765.74 14332 24887 18752.45 17646 19574 4687931 6709400 30.13
crit 169.75 40.46% 38276.86 29238 50769 38249.65 35991 39973 6497562 9299334 30.13
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 4109 1.6% 7.5 56.86sec 223740 222757 Direct 7.5 148597 334636 223754 40.4%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.53 7.53 0.00 0.00 1.0045 0.0000 1685376.90 2378842.90 29.15 222756.66 222756.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.49 59.61% 148597.20 13764 232123 145285.42 0 232123 667163 941724 28.73
crit 3.04 40.39% 334636.30 32041 524226 315969.56 0 524226 1018214 1437118 27.67
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s231056[When used on targets below 25% health, ][]{$?s231056=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Moonfire (lunar_inspiration) 17136 6.5% 17.6 23.50sec 394345 392581 Direct 17.6 38469 78402 54707 40.7%  
Periodic 145.9 28774 58697 40895 40.5% 59.8%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.57 17.57 145.94 145.94 1.0045 1.6408 6929453.64 6929453.64 0.00 26951.63 392581.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.43 59.34% 38469.09 29518 48797 38423.65 30994 44554 401091 401091 0.00
crit 7.15 40.66% 78401.90 60217 99547 78333.54 0 99547 560214 560214 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 86.8 59.50% 28774.46 64 37954 28723.11 25836 31000 2498413 2498413 0.00
crit 59.1 40.50% 58697.36 261 77426 58589.84 50927 64689 3469735 3469735 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 14390 5.3% 23.8 14.42sec 239509 0 Direct 23.8 168480 343577 239505 40.6%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.76 23.76 0.00 0.00 0.0000 0.0000 5690306.50 8365289.56 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.12 59.43% 168480.34 119382 197353 168412.20 141310 197353 2379029 3497398 31.98
crit 9.64 40.57% 343577.32 243539 402600 343465.53 243539 402600 3311277 4867891 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 24709 9.3% 19.0 22.52sec 526299 523956 Direct 19.0 62837 128100 89240 40.5%  
Periodic 110.7 52793 107761 75048 40.5% 46.4%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.01 19.01 110.73 110.73 1.0045 1.6800 10006517.40 10006517.40 0.00 48783.01 523956.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.32 59.55% 62837.08 45506 91011 62914.45 50056 76720 711415 711415 0.00
crit 7.69 40.45% 128099.78 92831 185663 128257.38 0 185663 985257 985257 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.9 59.52% 52792.89 91 104663 52900.19 41725 64948 3479099 3479099 0.00
crit 44.8 40.48% 107760.67 185 213512 107993.92 80577 137589 4830747 4830747 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][]$?a231052[ While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage.][] |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 39202 14.7% 14.7 23.68sec 1071346 1066563 Periodic 214.0 51890 105846 73715 40.5% 69.0%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.72 0.00 213.99 213.99 1.0045 1.2924 15774473.11 15774473.11 0.00 54143.43 1066563.43
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 127.4 59.55% 51890.12 37 65985 51822.03 46419 57181 6612484 6612484 0.00
crit 86.6 40.45% 105845.64 228 134610 105698.26 92964 117575 9161989 9161989 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 19433 7.4% 50.1 8.04sec 157538 156834 Direct 50.1 96738 197266 157539 60.5%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.12 50.12 0.00 0.00 1.0045 0.0000 7896289.49 11239827.45 29.75 156834.22 156834.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.81 39.52% 96737.85 57276 119345 96604.73 81381 108872 1916125 2727616 29.77
crit 30.32 60.48% 197265.72 116842 243464 196999.94 174811 216978 5980164 8512211 29.77
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing ${$sw1*$<mult>} Physical damage to the target.$?a231063[ Deals {$s5=20}% increased damage against bleeding targets.][]$?a231057[ While stealthed, Shred deals $m4% increased damage, and has double the chance to critically strike.][] |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Swipe (_cat) 75731 27.9% 60.2 4.83sec 496819 494594 Direct 361.2 58290 118919 82803 40.4%  

Stats details: swipe_cat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.20 361.21 0.00 0.00 1.0045 0.0000 29909092.87 43708604.37 31.57 494594.07 494594.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 215.17 59.57% 58289.96 38339 79887 58239.52 53260 64436 12542131 18328658 31.57
crit 146.04 40.43% 118918.96 78212 162969 118817.63 106602 131785 17366962 25379947 31.57
 
 

Action details: swipe_cat

Static Values
  • id:106785
  • school:physical
  • resource:energy
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.swipe_cat>=8
Spelldata
  • id:106785
  • name:Swipe
  • school:physical
  • tooltip:
  • description:Swipe nearby enemies, inflicting $sw3 Physical damage.$?a231283[ Deals {$s2=20}% increased damage against bleeding targets.][] |cFFFFFFFFAwards {$s1=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.00
 
Thrash (_cat) 37617 13.8% 22.7 13.02sec 653951 651036 Direct 136.3 20797 42432 29556 40.5%  
Periodic 547.8 13912 28375 19767 40.5% 260.4%

Stats details: thrash_cat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.72 136.33 547.85 547.85 1.0045 1.9040 14858592.91 14858592.91 0.00 13940.03 651035.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.14 59.52% 20796.97 16908 27951 20787.34 19050 22396 1687468 1687468 0.00
crit 55.19 40.48% 42432.36 34492 57020 42411.75 38503 46070 2341745 2341745 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 326.1 59.52% 13912.46 17 19907 13913.78 12595 15304 4536520 4536520 0.00
crit 221.8 40.48% 28375.44 35 40611 28378.63 25216 31350 6292860 6292860 0.00
 
 

Action details: thrash_cat

Static Values
  • id:106830
  • school:physical
  • resource:energy
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=duration*0.3&spell_targets.thrash_cat>=5
Spelldata
  • id:106830
  • name:Thrash
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2 sec.
  • description:Strikes all nearby enemies, dealing $m1 Bleed damage and an additional $o2 Bleed damage over {$d=15 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.410000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.292000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:10.05
  • base_tick_time:2.01
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Oinkie
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oinkie
  • harmful:false
  • if_expr:
 
Berserk 2.7 181.95sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
Dash 2.4 188.53sec

Stats details: dash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.38 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dash

Static Values
  • id:1850
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.cat_form.up
Spelldata
  • id:1850
  • name:Dash
  • school:physical
  • tooltip:Increased movement speed by {$s1=70}% while in Cat Form.
  • description:Activates Cat Form and increases movement speed by {$s1=70}% while in Cat Form for {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oinkie
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oinkie
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 14.4 28.80sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.38 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Skull Bash 13.5 30.41sec

Stats details: skull_bash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.46 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: skull_bash

Static Values
  • id:106839
  • school:physical
  • resource:none
  • range:13.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:106839
  • name:Skull Bash
  • school:physical
  • tooltip:
  • description:You charge and bash the target's skull, interrupting spellcasting and preventing any spell in that school from being cast for {$93985d=4 seconds}.
 
Tiger's Fury 13.6 30.32sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.59 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=20} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 
Wild Charge 15.9 24.53sec

Stats details: wild_charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.94 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: wild_charge

Static Values
  • id:102401
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:102401
  • name:Wild Charge
  • school:physical
  • tooltip:Flying to an ally's position.
  • description:Fly to a nearby ally's position.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Acceleration 6.4 1.1 57.9sec 48.0sec 17.12% 17.12% 1.1(1.1) 6.2

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_acceleration
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:4926.91

Stack Uptimes

  • acceleration_1:17.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214128
  • name:Acceleration
  • tooltip:Haste increased by $w1. Movement speed increased by $w2%.
  • description:{$@spelldesc214120=Your spells and abilities have a chance to grant you {$214128s1=4657} Haste and {$214128s2=15}% movement speed for {$214128d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Ashamane's Energy 13.6 0.0 30.3sec 30.3sec 10.14% 10.14% 40.6(40.6) 13.5

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:20.00

Stack Uptimes

  • ashamanes_energy_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 2.7 0.0 182.0sec 182.0sec 9.91% 18.76% 0.0(0.0) 2.6

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 9.97% 0.0(0.0) 1.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 36.2 0.5 10.9sec 10.7sec 3.62% 17.45% 0.5(0.5) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:3.62%

Trigger Attempt Success

  • trigger_pct:8.74%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Dash 2.4 0.0 188.6sec 188.6sec 8.74% 10.90% 0.0(0.0) 2.3

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_dash
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.70

Stack Uptimes

  • dash_1:8.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1850
  • name:Dash
  • tooltip:Increased movement speed by {$s1=70}% while in Cat Form.
  • description:Activates Cat Form and increases movement speed by {$s1=70}% while in Cat Form for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Feral Instinct 2.7 0.0 182.0sec 182.0sec 9.91% 13.62% 0.0(0.0) 2.6

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_feral_instinct
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • feral_instinct_1:9.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210649
  • name:Feral Instinct
  • tooltip:Damage dealt increased by $w1%.
  • description:{$@spelldesc210631={$?s102543=false}[Incarnation: King of the Jungle][Berserk] increases all damage you deal by {$s1=5}% for {$210649d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 291.8sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 15.7 19.8 25.2sec 11.3sec 82.31% 82.31% 19.8(19.8) 14.8

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:82.31%

Trigger Attempt Success

  • trigger_pct:96.78%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Regrowth, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Regrowth, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 1.54% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
raid_movement 33.8 1.0 11.6sec 11.3sec 6.61% 6.61% 1.0(1.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:6.61%

Trigger Attempt Success

  • trigger_pct:100.00%
Savage Roar 11.4 3.0 32.2sec 28.8sec 80.83% 80.20% 162.5(162.5) 10.4

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:80.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Scent of Blood 22.7 0.0 13.0sec 13.0sec 23.01% 53.00% 0.0(0.0) 22.7

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_scent_of_blood
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-2.00

Stack Uptimes

  • scent_of_blood_1:23.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210664
  • name:Scent of Blood
  • tooltip:Energy cost of {$?s202028=false}[Brutal Slash][Swipe] reduced by $w1.
  • description:{$@spelldesc210663=Each target hit by Thrash reduces the cost of {$?s202028=false}[Brutal Slash][Swipe] by {$s1=2} Energy for the next {$210664d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Tiger's Fury 13.6 0.0 30.3sec 30.3sec 26.89% 31.70% 0.0(0.0) 13.3

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=20} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
wild_charge_movement 15.9 0.0 24.5sec 24.5sec 0.98% 14.38% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_wild_charge_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • wild_charge_movement_1:0.98%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Cat Form

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Defiled Augmentation

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Oinkie
ferocious_bite Energy 15.1 232.9 15.5 30.9 7237.7
ferocious_bite Combo Points 7.5 31.9 4.2 4.2 52777.7
lunar_inspiration Energy 17.6 414.8 23.6 23.6 16703.9
rake Energy 19.0 531.0 27.9 27.9 18844.6
rip Energy 14.7 326.7 22.2 22.2 48279.7
rip Combo Points 14.7 73.6 5.0 5.0 214266.2
savage_roar Energy 14.4 422.7 29.4 29.4 0.0
savage_roar Combo Points 14.4 71.9 5.0 5.0 0.0
shred Energy 50.1 1290.4 25.7 25.7 6119.2
swipe_cat Energy 60.2 1729.8 28.7 28.7 17290.6
thrash_cat Energy 22.7 916.3 40.3 40.3 16215.6
Resource Gains Type Count Total Average Overflow
rake Combo Points 19.01 18.95 (10.49%) 1.00 0.06 0.33%
tigers_fury Energy 13.59 271.77 (3.78%) 20.00 0.00 0.00%
swipe_cat Combo Points 60.20 0.60 (0.33%) 0.01 0.00 0.36%
lunar_inspiration Combo Points 17.57 17.53 (9.70%) 1.00 0.05 0.27%
shred Combo Points 50.12 50.09 (27.74%) 1.00 0.03 0.07%
energy_regen Energy 1521.13 4714.64 (65.63%) 3.10 4.76 0.10%
clearcasting Energy 36.12 1388.36 (19.33%) 38.44 0.00 0.00%
ashamanes_energy Energy 40.57 809.33 (11.27%) 19.95 2.11 0.26%
primal_fury Combo Points 102.67 93.43 (51.73%) 0.91 9.24 9.00%
Resource RPS-Gain RPS-Loss
Energy 14.47 14.64
Combo Points 0.45 0.44
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 29.23 0.01 98.17
Astral Power 0.00 0.00 0.00
Combo Points 3.18 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.0%

Procs

Count Interval
clearcasting 36.7 10.7sec
clearcasting_wasted 0.5 125.6sec
primal_fury 102.7 3.9sec

Statistics & Data Analysis

Fight Length
Sample Data Oinkie Fight Length
Count 9999
Mean 400.62
Minimum 307.54
Maximum 499.01
Spread ( max - min ) 191.47
Range [ ( max - min ) / 2 * 100% ] 23.90%
DPS
Sample Data Oinkie Damage Per Second
Count 9999
Mean 268433.53
Minimum 227448.09
Maximum 312276.18
Spread ( max - min ) 84828.09
Range [ ( max - min ) / 2 * 100% ] 15.80%
Standard Deviation 11071.0623
5th Percentile 251175.98
95th Percentile 287583.31
( 95th Percentile - 5th Percentile ) 36407.34
Mean Distribution
Standard Deviation 110.7162
95.00% Confidence Intervall ( 268216.53 - 268650.53 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 65
0.1% Error 6534
0.1 Scale Factor Error with Delta=300 1046314
0.05 Scale Factor Error with Delta=300 4185258
0.01 Scale Factor Error with Delta=300 104631452
Priority Target DPS
Sample Data Oinkie Priority Target Damage Per Second
Count 9999
Mean 170021.46
Minimum 123081.39
Maximum 205798.09
Spread ( max - min ) 82716.70
Range [ ( max - min ) / 2 * 100% ] 24.33%
Standard Deviation 11459.7681
5th Percentile 149511.58
95th Percentile 187128.68
( 95th Percentile - 5th Percentile ) 37617.11
Mean Distribution
Standard Deviation 114.6034
95.00% Confidence Intervall ( 169796.84 - 170246.08 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 174
0.1% Error 17451
0.1 Scale Factor Error with Delta=300 1121076
0.05 Scale Factor Error with Delta=300 4484306
0.01 Scale Factor Error with Delta=300 112107670
DPS(e)
Sample Data Oinkie Damage Per Second (Effective)
Count 9999
Mean 268433.53
Minimum 227448.09
Maximum 312276.18
Spread ( max - min ) 84828.09
Range [ ( max - min ) / 2 * 100% ] 15.80%
Damage
Sample Data Oinkie Damage
Count 9999
Mean 107312750.28
Minimum 78608580.10
Maximum 137004877.34
Spread ( max - min ) 58396297.23
Range [ ( max - min ) / 2 * 100% ] 27.21%
DTPS
Sample Data Oinkie Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Oinkie Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Oinkie Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Oinkie Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Oinkie Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Oinkie Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data OinkieTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Oinkie Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 cat_form
4 0.00 prowl
5 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
6 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
7 15.94 wild_charge
0.00 displacer_beast,if=movement.distance>10
8 2.38 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
9 1.00 rake,if=buff.prowl.up
A 34.74 auto_attack
B 13.46 skull_bash
C 2.71 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
D 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
E 13.66 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
F 3.74 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
G 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
H 0.00 call_action_list,name=finisher
I 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
J 11.36 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
K 22.72 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
L 14.72 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
M 3.02 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
N 0.03 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
O 3.80 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
0.00 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
P 60.17 swipe_cat,if=spell_targets.swipe_cat>=6
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
Q 18.01 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
R 17.57 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
S 50.12 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

0123469ARBSECSJSSSSLSQ7RAOSSSOSS8KPAPPLPKAPPEPPPJBQARS7AKPKAPJEPPPQR7ALBSAKPP7AKEPJPPQRLSSS7AKABLPKP7APEPPJQRSS7AKPLPKPPBPP7AEJPKQRSL7KAAPPKPPECPPAKBPJQRSLSSSO7KAP8ABPKPPEPJKAQRBS7AKPLAPPKPPEPBJPQR7ASLSAKBPPPL7APKPEPPQJARSB7AKPPLPAKPEPPPJQRSALSQRBS7AFSEQRSJSSS7AFQRDSS7AFECQRSSJBSSSOSSQO7RASSMQS

Sample Sequence Table

time name target resources buffs
Pre flask Oinkie 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre food Oinkie 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre augmentation Oinkie 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points potion_of_the_old_war
0:01.004 lunar_inspiration Fluffy_Pillow 76.5/100: 77% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, potion_of_the_old_war
0:02.010 skull_bash Fluffy_Pillow 61.1/100: 61% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, potion_of_the_old_war
0:02.010 shred Fluffy_Pillow 61.1/100: 61% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, potion_of_the_old_war
0:03.015 tigers_fury Fluffy_Pillow 35.6/100: 36% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, potion_of_the_old_war
0:03.015 berserk Fluffy_Pillow 55.6/100: 56% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, tigers_fury, potion_of_the_old_war
0:03.015 shred Fluffy_Pillow 55.6/150: 37% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, feral_instinct, ashamanes_energy, berserk, tigers_fury, potion_of_the_old_war
0:04.019 savage_roar Fluffy_Pillow 70.2/150: 47% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, clearcasting, feral_instinct, ashamanes_energy, berserk, tigers_fury, potion_of_the_old_war
0:05.023 shred Fluffy_Pillow 104.7/150: 70% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, feral_instinct, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:06.028 shred Fluffy_Pillow 119.2/150: 79% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, clearcasting, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:07.034 shred Fluffy_Pillow 133.8/150: 89% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, clearcasting, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:08.037 shred Fluffy_Pillow 148.3/150: 99% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:09.043 rip Fluffy_Pillow 142.9/150: 95% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:10.047 shred Fluffy_Pillow 142.4/150: 95% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:11.051 rake Fluffy_Pillow 136.9/150: 91% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:12.054 wild_charge Fluffy_Pillow 133.9/150: 89% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, raid_movement, feral_instinct, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:12.054 lunar_inspiration Fluffy_Pillow 133.9/150: 89% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, raid_movement, wild_charge_movement, feral_instinct, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:12.254 auto_attack Fluffy_Pillow 118.9/150: 79% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:13.059 ferocious_bite Fluffy_Pillow 133.5/150: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:14.063 shred Fluffy_Pillow 123.0/150: 82% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:15.069 shred Fluffy_Pillow 117.6/150: 78% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, clearcasting, feral_instinct, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:16.073 shred Fluffy_Pillow 132.1/150: 88% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:17.076 ferocious_bite Fluffy_Pillow 126.6/150: 84% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:18.081 shred Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:19.086 shred Fluffy_Pillow 74.5/100: 75% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, potion_of_the_old_war
0:20.091 dash Fluffy_Pillow 89.1/100: 89% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, raid_movement, predatory_swiftness, savage_roar, potion_of_the_old_war
0:20.091 thrash_cat Fluffy_Pillow 89.1/100: 89% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, raid_movement, dash, predatory_swiftness, savage_roar, potion_of_the_old_war
0:21.099 swipe_cat Fluffy_Pillow 53.7/100: 54% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, raid_movement, dash, predatory_swiftness, savage_roar, scent_of_blood, potion_of_the_old_war
0:21.699 auto_attack Fluffy_Pillow 20.7/100: 21% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, dash, predatory_swiftness, savage_roar, scent_of_blood, potion_of_the_old_war
0:22.106 swipe_cat Fluffy_Pillow 35.2/100: 35% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, dash, predatory_swiftness, savage_roar, scent_of_blood, potion_of_the_old_war
0:24.641 swipe_cat Fluffy_Pillow 38.9/100: 39% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, clearcasting, dash, predatory_swiftness, savage_roar
0:25.646 rip Fluffy_Pillow 53.5/100: 53% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, dash, predatory_swiftness, savage_roar
0:26.649 swipe_cat Fluffy_Pillow 38.0/100: 38% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, clearcasting, dash, predatory_swiftness, savage_roar
0:27.652 thrash_cat Fluffy_Pillow 52.5/100: 53% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, dash, predatory_swiftness, savage_roar
0:28.552 auto_attack Fluffy_Pillow 6.4/100: 6% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, dash, predatory_swiftness, scent_of_blood
0:29.936 swipe_cat Fluffy_Pillow 35.6/100: 36% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, dash, predatory_swiftness, scent_of_blood
0:32.991 swipe_cat Fluffy_Pillow 46.8/100: 47% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, dash, predatory_swiftness
0:33.995 tigers_fury Fluffy_Pillow 16.3/100: 16% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points bloodlust, dash, predatory_swiftness
0:34.762 swipe_cat Fluffy_Pillow 47.4/100: 47% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points bloodlust, dash, ashamanes_energy, predatory_swiftness, tigers_fury
0:36.023 swipe_cat Fluffy_Pillow 60.6/100: 61% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points bloodlust, ashamanes_energy, predatory_swiftness, tigers_fury
0:37.028 swipe_cat Fluffy_Pillow 50.2/100: 50% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points bloodlust, predatory_swiftness, tigers_fury
0:39.561 savage_roar Fluffy_Pillow 41.8/100: 42% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, tigers_fury
0:40.566 skull_bash Fluffy_Pillow 16.4/100: 16% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:42.356 rake Fluffy_Pillow 37.7/100: 38% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
0:43.360 Waiting 1.495 sec 13.9/100: 14% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
0:44.855 auto_attack Fluffy_Pillow 30.6/100: 31% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
0:44.855 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
0:45.859 Waiting 2.591 sec 11.7/100: 12% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:48.450 shred Fluffy_Pillow 40.6/100: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:49.455 Waiting 1.189 sec 11.8/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:50.644 wild_charge Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points raid_movement, predatory_swiftness, savage_roar
0:51.100 auto_attack Fluffy_Pillow 27.8/100: 28% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:52.942 thrash_cat Fluffy_Pillow 50.6/100: 51% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points savage_roar
0:55.985 swipe_cat Fluffy_Pillow 34.5/100: 34% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points savage_roar, scent_of_blood
1:00.567 thrash_cat Fluffy_Pillow 52.5/100: 52% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, savage_roar
1:00.867 auto_attack Fluffy_Pillow 2.5/100: 2% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points savage_roar, scent_of_blood
1:02.848 swipe_cat Fluffy_Pillow 27.9/100: 28% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, savage_roar, scent_of_blood
1:03.854 savage_roar Fluffy_Pillow 51.1/100: 51% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points scent_of_blood
1:04.859 tigers_fury Fluffy_Pillow 22.2/100: 22% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
1:05.113 swipe_cat Fluffy_Pillow 45.1/100: 45% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:06.883 swipe_cat Fluffy_Pillow 59.8/100: 60% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:07.887 swipe_cat Fluffy_Pillow 45.9/100: 46% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
1:11.185 rake Fluffy_Pillow 37.7/100: 38% energy | 704000.0/704000: 100% mana | 2.0/5: 41% combo_points predatory_swiftness, savage_roar, tigers_fury
1:12.188 Waiting 1.503 sec 13.8/100: 14% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points predatory_swiftness, savage_roar, tigers_fury
1:13.691 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points predatory_swiftness, savage_roar
1:14.697 Waiting 1.389 sec 11.8/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:16.086 wild_charge Fluffy_Pillow 27.2/100: 27% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, savage_roar
1:16.086 Waiting 0.100 sec 27.2/100: 27% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, wild_charge_movement, savage_roar
1:16.186 auto_attack Fluffy_Pillow 28.3/100: 28% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points wild_charge_movement, savage_roar
1:16.186 Waiting 0.200 sec 28.3/100: 28% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points wild_charge_movement, savage_roar
1:16.386 rip Fluffy_Pillow 30.6/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points savage_roar
1:17.389 skull_bash Fluffy_Pillow 11.7/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
1:17.389 Waiting 2.592 sec 11.7/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
1:19.981 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, acceleration
1:22.466 auto_attack Fluffy_Pillow 30.5/100: 31% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, acceleration
1:23.798 thrash_cat Fluffy_Pillow 50.4/100: 50% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, acceleration
1:26.334 swipe_cat Fluffy_Pillow 33.2/100: 33% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, scent_of_blood, acceleration
1:29.893 swipe_cat Fluffy_Pillow 46.1/100: 46% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points
1:32.175 wild_charge Fluffy_Pillow 26.5/100: 27% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement
1:32.275 auto_attack Fluffy_Pillow 26.5/100: 27% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points wild_charge_movement
1:34.472 thrash_cat Fluffy_Pillow 52.1/100: 52% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points
1:35.475 tigers_fury Fluffy_Pillow 13.2/100: 13% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points scent_of_blood
1:35.475 swipe_cat Fluffy_Pillow 33.2/100: 33% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points ashamanes_energy, scent_of_blood, tigers_fury
1:37.251 savage_roar Fluffy_Pillow 42.5/100: 43% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points ashamanes_energy, scent_of_blood, tigers_fury, acceleration
1:38.255 swipe_cat Fluffy_Pillow 35.5/100: 36% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, scent_of_blood, tigers_fury, acceleration
1:39.261 swipe_cat Fluffy_Pillow 35.6/100: 36% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, acceleration
1:40.268 rake Fluffy_Pillow 48.6/100: 49% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, acceleration
1:41.274 Waiting 0.300 sec 26.6/100: 27% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, acceleration
1:41.574 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, acceleration
1:42.579 Waiting 1.284 sec 13.5/100: 14% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, acceleration
1:43.863 rip Fluffy_Pillow 30.2/100: 30% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, acceleration
1:44.868 shred Fluffy_Pillow 13.2/100: 13% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, acceleration
1:45.872 shred Fluffy_Pillow 26.2/100: 26% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
1:46.878 Waiting 0.300 sec 37.4/100: 37% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:47.178 shred Fluffy_Pillow 40.7/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:48.182 wild_charge Fluffy_Pillow 11.9/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness, savage_roar
1:48.182 Waiting 1.177 sec 11.9/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar
1:49.359 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:49.359 Waiting 0.700 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:51.843 thrash_cat Fluffy_Pillow 52.6/100: 53% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness, savage_roar
1:52.543 auto_attack Fluffy_Pillow 2.6/100: 3% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, scent_of_blood
1:54.122 skull_bash Fluffy_Pillow 28.0/100: 28% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, scent_of_blood
1:54.376 rip Fluffy_Pillow_Add1 30.8/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, scent_of_blood
1:58.454 swipe_cat Fluffy_Pillow 46.2/100: 46% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
1:59.460 thrash_cat Fluffy_Pillow 12.4/100: 12% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
2:01.488 swipe_cat Fluffy_Pillow 35.0/100: 35% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, scent_of_blood
2:04.021 wild_charge Fluffy_Pillow 30.2/100: 30% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, predatory_swiftness
2:04.221 auto_attack Fluffy_Pillow 30.2/100: 30% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
2:05.557 swipe_cat Fluffy_Pillow 47.3/100: 47% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
2:06.561 tigers_fury Fluffy_Pillow 13.5/100: 13% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points
2:07.585 swipe_cat Fluffy_Pillow 64.9/100: 65% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points ashamanes_energy, tigers_fury
2:08.590 swipe_cat Fluffy_Pillow 51.1/100: 51% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points ashamanes_energy, tigers_fury
2:09.595 savage_roar Fluffy_Pillow 37.3/100: 37% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, tigers_fury
2:10.599 rake Fluffy_Pillow 48.4/100: 48% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury
2:11.604 lunar_inspiration Fluffy_Pillow 24.6/100: 25% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
2:12.608 Waiting 0.400 sec 35.8/100: 36% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
2:13.008 shred Fluffy_Pillow 40.3/100: 40% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
2:14.012 Waiting 2.618 sec 11.4/100: 11% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
2:16.630 shred Fluffy_Pillow 40.6/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:17.633 Waiting 2.391 sec 11.7/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:20.024 wild_charge Fluffy_Pillow 38.4/100: 38% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, predatory_swiftness, savage_roar
2:20.124 auto_attack Fluffy_Pillow 38.4/100: 38% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points wild_charge_movement, predatory_swiftness, savage_roar
2:21.303 thrash_cat Fluffy_Pillow 52.6/100: 53% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:24.096 swipe_cat Fluffy_Pillow 33.7/100: 34% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points savage_roar, scent_of_blood
2:25.611 rip Fluffy_Pillow_Add1 17.6/100: 18% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, savage_roar
2:28.148 swipe_cat Fluffy_Pillow 45.8/100: 46% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
2:29.151 thrash_cat Fluffy_Pillow 12.0/100: 12% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
2:30.157 swipe_cat Fluffy_Pillow 23.2/100: 23% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, scent_of_blood
2:31.163 swipe_cat Fluffy_Pillow 46.4/100: 46% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, scent_of_blood
2:32.168 skull_bash Fluffy_Pillow 24.5/100: 25% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points clearcasting, predatory_swiftness, savage_roar, scent_of_blood
2:32.168 swipe_cat Fluffy_Pillow 24.5/100: 25% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points clearcasting, predatory_swiftness, savage_roar, scent_of_blood
2:33.173 swipe_cat Fluffy_Pillow 47.7/100: 48% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points predatory_swiftness, savage_roar
2:36.225 wild_charge Fluffy_Pillow 36.7/100: 37% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness
2:36.425 auto_attack Fluffy_Pillow 36.7/100: 37% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
2:36.482 tigers_fury Fluffy_Pillow 39.6/100: 40% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
2:36.561 savage_roar Fluffy_Pillow 60.4/100: 60% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
2:37.565 swipe_cat Fluffy_Pillow 51.6/100: 52% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:39.591 thrash_cat Fluffy_Pillow 69.2/100: 69% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
2:40.596 rake Fluffy_Pillow 30.4/100: 30% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, scent_of_blood, tigers_fury
2:41.600 lunar_inspiration Fluffy_Pillow 41.5/100: 42% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, scent_of_blood, tigers_fury
2:42.606 Waiting 1.602 sec 22.7/100: 23% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, scent_of_blood, tigers_fury
2:44.208 shred Fluffy_Pillow 40.6/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
2:45.214 Waiting 1.688 sec 11.8/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:46.902 rip Fluffy_Pillow 30.6/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:47.909 Waiting 2.188 sec 11.8/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
2:51.121 wild_charge Fluffy_Pillow 47.5/100: 48% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, predatory_swiftness, savage_roar
2:51.481 thrash_cat Fluffy_Pillow 51.5/100: 52% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar
2:51.581 auto_attack Fluffy_Pillow 1.5/100: 2% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, scent_of_blood
2:52.481 auto_attack Fluffy_Pillow 1.5/100: 2% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, scent_of_blood
2:54.531 swipe_cat Fluffy_Pillow 35.5/100: 35% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, scent_of_blood
2:58.095 swipe_cat Fluffy_Pillow 42.2/100: 42% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
2:59.100 thrash_cat Fluffy_Pillow 53.4/100: 53% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points savage_roar
3:01.898 swipe_cat Fluffy_Pillow 34.5/100: 34% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points scent_of_blood
3:05.964 swipe_cat Fluffy_Pillow 46.8/100: 47% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points
3:06.969 tigers_fury Fluffy_Pillow 12.9/100: 13% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points clearcasting
3:06.969 berserk Fluffy_Pillow 32.9/100: 33% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points clearcasting, ashamanes_energy, tigers_fury
3:06.969 swipe_cat Fluffy_Pillow 32.9/150: 22% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points clearcasting, feral_instinct, ashamanes_energy, berserk, tigers_fury
3:07.973 swipe_cat Fluffy_Pillow 64.1/150: 43% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points feral_instinct, ashamanes_energy, berserk, tigers_fury
3:08.873 auto_attack Fluffy_Pillow 41.6/150: 28% energy | 704000.0/704000: 100% mana | 4.1/5: 81% combo_points feral_instinct, ashamanes_energy, berserk, tigers_fury
3:08.977 thrash_cat Fluffy_Pillow 72.8/150: 49% energy | 704000.0/704000: 100% mana | 4.1/5: 81% combo_points feral_instinct, ashamanes_energy, berserk, tigers_fury
3:09.982 skull_bash Fluffy_Pillow 79.0/150: 53% energy | 704000.0/704000: 100% mana | 4.1/5: 81% combo_points feral_instinct, berserk, scent_of_blood, tigers_fury
3:09.982 swipe_cat Fluffy_Pillow 79.0/150: 53% energy | 704000.0/704000: 100% mana | 4.1/5: 81% combo_points feral_instinct, berserk, scent_of_blood, tigers_fury
3:10.986 savage_roar Fluffy_Pillow 73.7/150: 49% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points feral_instinct, berserk, scent_of_blood, tigers_fury
3:11.989 rake Fluffy_Pillow 64.8/150: 43% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, scent_of_blood, tigers_fury
3:12.992 lunar_inspiration Fluffy_Pillow 58.5/150: 39% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury
3:13.996 shred Fluffy_Pillow 54.7/150: 36% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury
3:15.001 rip Fluffy_Pillow 45.9/150: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar
3:16.005 shred Fluffy_Pillow 42.0/150: 28% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, feral_instinct, berserk, predatory_swiftness, savage_roar
3:17.010 shred Fluffy_Pillow 53.2/150: 35% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar
3:18.015 shred Fluffy_Pillow 44.4/150: 30% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar
3:19.018 ferocious_bite Fluffy_Pillow 35.6/150: 24% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar
3:20.023 wild_charge Fluffy_Pillow 21.8/150: 15% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, feral_instinct, berserk, predatory_swiftness, savage_roar
3:20.534 thrash_cat Fluffy_Pillow 27.5/150: 18% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, wild_charge_movement, feral_instinct, berserk, predatory_swiftness, savage_roar
3:20.634 auto_attack Fluffy_Pillow 2.5/150: 2% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, scent_of_blood
3:23.324 swipe_cat Fluffy_Pillow 33.5/100: 34% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, scent_of_blood
3:24.329 dash Fluffy_Pillow 11.7/100: 12% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, predatory_swiftness, savage_roar, scent_of_blood
3:24.686 auto_attack Fluffy_Pillow 14.6/100: 15% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points dash, predatory_swiftness, savage_roar
3:27.142 skull_bash Fluffy_Pillow 43.0/100: 43% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points dash, predatory_swiftness, savage_roar
3:27.398 swipe_cat Fluffy_Pillow 45.9/100: 46% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points dash, predatory_swiftness, savage_roar
3:29.422 thrash_cat Fluffy_Pillow 23.4/100: 23% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, dash, predatory_swiftness, savage_roar
3:30.426 swipe_cat Fluffy_Pillow 34.6/100: 35% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points dash, predatory_swiftness, savage_roar, scent_of_blood
3:34.499 swipe_cat Fluffy_Pillow 46.9/100: 47% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points dash, savage_roar
3:36.779 tigers_fury Fluffy_Pillow 27.3/100: 27% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points dash
3:36.969 swipe_cat Fluffy_Pillow 49.4/100: 49% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points dash, ashamanes_energy, tigers_fury
3:38.483 savage_roar Fluffy_Pillow 41.3/100: 41% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points dash, ashamanes_energy, tigers_fury
3:39.997 thrash_cat Fluffy_Pillow 58.1/100: 58% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury
3:40.797 auto_attack Fluffy_Pillow 8.1/100: 8% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, scent_of_blood, tigers_fury
3:42.528 rake Fluffy_Pillow 36.3/100: 36% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, scent_of_blood, tigers_fury
3:43.533 Waiting 1.624 sec 12.5/100: 12% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, scent_of_blood, tigers_fury
3:45.157 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:46.161 skull_bash Fluffy_Pillow 11.7/100: 12% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:46.161 Waiting 2.591 sec 11.7/100: 12% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:48.752 shred Fluffy_Pillow 40.6/100: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:49.756 Waiting 1.189 sec 11.8/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:50.945 wild_charge Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, savage_roar
3:51.301 auto_attack Fluffy_Pillow 27.8/100: 28% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points savage_roar
3:53.248 thrash_cat Fluffy_Pillow 50.6/100: 51% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, savage_roar
3:54.253 swipe_cat Fluffy_Pillow 61.8/100: 62% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points savage_roar, scent_of_blood
3:55.257 rip Fluffy_Pillow 40.0/100: 40% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points savage_roar, scent_of_blood
3:56.869 auto_attack Fluffy_Pillow 26.8/100: 27% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, scent_of_blood
3:58.557 swipe_cat Fluffy_Pillow 46.7/100: 47% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
3:59.816 swipe_cat Fluffy_Pillow 15.7/100: 16% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
4:00.820 thrash_cat Fluffy_Pillow 26.9/100: 27% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
4:01.824 swipe_cat Fluffy_Pillow 38.1/100: 38% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, scent_of_blood
4:04.357 swipe_cat Fluffy_Pillow 33.3/100: 33% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points predatory_swiftness, scent_of_blood
4:06.890 tigers_fury Fluffy_Pillow 28.5/100: 28% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points predatory_swiftness
4:06.969 swipe_cat Fluffy_Pillow 49.4/100: 49% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
4:08.228 skull_bash Fluffy_Pillow 40.1/100: 40% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points ashamanes_energy, tigers_fury, acceleration
4:08.228 savage_roar Fluffy_Pillow 40.1/100: 40% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points ashamanes_energy, tigers_fury, acceleration
4:09.233 swipe_cat Fluffy_Pillow 33.1/100: 33% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, acceleration
4:10.238 rake Fluffy_Pillow 66.1/100: 66% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, acceleration
4:11.243 lunar_inspiration Fluffy_Pillow 44.1/100: 44% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, acceleration
4:12.245 wild_charge Fluffy_Pillow 27.1/100: 27% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, predatory_swiftness, savage_roar, tigers_fury, acceleration
4:12.245 Waiting 0.100 sec 27.1/100: 27% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar, tigers_fury, acceleration
4:12.345 auto_attack Fluffy_Pillow 28.4/100: 28% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points wild_charge_movement, predatory_swiftness, savage_roar, tigers_fury, acceleration
4:12.345 Waiting 0.900 sec 28.4/100: 28% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points wild_charge_movement, predatory_swiftness, savage_roar, tigers_fury, acceleration
4:13.245 shred Fluffy_Pillow 40.0/100: 40% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, acceleration
4:14.250 Waiting 1.322 sec 13.0/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, acceleration
4:15.572 rip Fluffy_Pillow 30.2/100: 30% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, acceleration
4:16.578 Waiting 2.111 sec 13.2/100: 13% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, acceleration
4:18.689 shred Fluffy_Pillow 40.5/100: 41% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, acceleration
4:19.694 Waiting 0.883 sec 13.6/100: 14% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, acceleration
4:22.560 auto_attack Fluffy_Pillow 48.1/100: 48% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, acceleration
4:22.616 thrash_cat Fluffy_Pillow 51.4/100: 51% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, acceleration
4:23.621 skull_bash Fluffy_Pillow 14.4/100: 14% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, scent_of_blood, acceleration
4:23.621 swipe_cat Fluffy_Pillow 14.4/100: 14% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, scent_of_blood, acceleration
4:24.625 swipe_cat Fluffy_Pillow 39.0/100: 39% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, scent_of_blood, acceleration
4:25.630 swipe_cat Fluffy_Pillow 19.0/100: 19% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, scent_of_blood, acceleration
4:26.635 rip Fluffy_Pillow_Add1 44.0/100: 44% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, acceleration
4:28.152 wild_charge Fluffy_Pillow 33.6/100: 34% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, predatory_swiftness, savage_roar, acceleration
4:28.352 auto_attack Fluffy_Pillow 33.6/100: 34% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, acceleration
4:29.175 swipe_cat Fluffy_Pillow 46.9/100: 47% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, acceleration
4:32.996 thrash_cat Fluffy_Pillow 51.4/100: 51% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, acceleration
4:35.790 swipe_cat Fluffy_Pillow 34.6/100: 35% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, scent_of_blood
4:36.795 tigers_fury Fluffy_Pillow 12.7/100: 13% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, scent_of_blood
4:36.969 swipe_cat Fluffy_Pillow 34.7/100: 35% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, scent_of_blood, tigers_fury
4:38.998 swipe_cat Fluffy_Pillow 64.3/100: 64% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points ashamanes_energy, tigers_fury
4:40.003 rake Fluffy_Pillow 50.5/100: 50% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points tigers_fury
4:42.282 savage_roar Fluffy_Pillow 40.8/100: 41% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points tigers_fury
4:43.286 Waiting 1.567 sec 12.0/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury
4:44.853 auto_attack Fluffy_Pillow 29.4/100: 29% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury
4:44.853 Waiting 0.100 sec 29.4/100: 29% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury
4:44.953 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury
4:45.958 Waiting 2.590 sec 11.7/100: 12% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:48.548 shred Fluffy_Pillow 40.6/100: 41% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:49.553 skull_bash Fluffy_Pillow 11.8/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:49.553 Waiting 1.188 sec 11.8/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:50.741 wild_charge Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points raid_movement, predatory_swiftness, savage_roar
4:51.196 auto_attack Fluffy_Pillow 27.8/100: 28% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:52.271 thrash_cat Fluffy_Pillow 42.0/100: 42% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
4:53.275 swipe_cat Fluffy_Pillow 53.2/100: 53% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, scent_of_blood
4:54.281 swipe_cat Fluffy_Pillow 76.4/100: 76% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, scent_of_blood
4:55.286 rip Fluffy_Pillow_Add1 54.6/100: 55% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points savage_roar, scent_of_blood
4:57.315 swipe_cat Fluffy_Pillow 47.2/100: 47% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
5:00.817 auto_attack Fluffy_Pillow 38.9/100: 39% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:01.636 thrash_cat Fluffy_Pillow 50.3/100: 50% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:04.682 swipe_cat Fluffy_Pillow 34.2/100: 34% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, scent_of_blood
5:06.966 tigers_fury Fluffy_Pillow 26.6/100: 27% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
5:06.969 swipe_cat Fluffy_Pillow 46.6/100: 47% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
5:08.225 swipe_cat Fluffy_Pillow 35.6/100: 36% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points clearcasting, ashamanes_energy, tigers_fury
5:09.231 swipe_cat Fluffy_Pillow 66.8/100: 67% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points ashamanes_energy, tigers_fury
5:10.237 savage_roar Fluffy_Pillow 53.0/100: 53% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points tigers_fury
5:11.752 rake Fluffy_Pillow 29.9/100: 30% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
5:12.757 lunar_inspiration Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
5:13.764 Waiting 1.643 sec 22.3/100: 22% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
5:15.407 shred Fluffy_Pillow 40.6/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:16.413 Waiting 1.188 sec 11.8/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness, savage_roar
5:17.601 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:17.601 Waiting 0.500 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:18.101 rip Fluffy_Pillow 30.6/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:19.106 Waiting 2.590 sec 11.8/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
5:21.696 shred Fluffy_Pillow 40.6/100: 41% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
5:25.001 rake Fluffy_Pillow 37.4/100: 37% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:26.005 Waiting 1.528 sec 13.6/100: 14% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:27.533 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:28.538 Waiting 1.690 sec 11.7/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:30.228 skull_bash Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points savage_roar, acceleration
5:30.228 Waiting 0.800 sec 30.7/100: 31% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points savage_roar, acceleration
5:31.028 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points clearcasting, savage_roar, acceleration
5:32.032 wild_charge Fluffy_Pillow 54.1/100: 54% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, savage_roar, acceleration
5:32.032 Waiting 0.200 sec 54.1/100: 54% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, wild_charge_movement, savage_roar, acceleration
5:32.232 auto_attack Fluffy_Pillow 56.7/100: 57% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points savage_roar, acceleration
5:32.232 ferocious_bite Fluffy_Pillow 56.7/100: 57% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points savage_roar, acceleration
5:33.237 Waiting 1.611 sec 19.7/100: 20% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, acceleration
5:34.848 shred Fluffy_Pillow 40.5/100: 41% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, acceleration
5:36.872 tigers_fury Fluffy_Pillow 26.7/100: 27% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, acceleration
5:36.969 rake Fluffy_Pillow 48.0/100: 48% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, acceleration
5:37.973 lunar_inspiration Fluffy_Pillow 46.0/100: 46% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, acceleration
5:38.978 shred Fluffy_Pillow 49.0/100: 49% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, acceleration
5:39.981 savage_roar Fluffy_Pillow 42.0/100: 42% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury, acceleration
5:40.985 Waiting 2.433 sec 13.5/100: 13% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury
5:43.418 shred Fluffy_Pillow 40.6/100: 41% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury
5:44.424 shred Fluffy_Pillow 11.8/100: 12% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
5:45.431 Waiting 1.580 sec 23.0/100: 23% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:47.011 shred Fluffy_Pillow 40.6/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:48.016 wild_charge Fluffy_Pillow 11.8/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness, savage_roar
5:48.016 Waiting 1.188 sec 11.8/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar
5:49.204 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:49.204 Waiting 0.100 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:49.304 ferocious_bite Fluffy_Pillow 26.1/100: 26% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:52.613 rake Fluffy_Pillow 36.8/100: 37% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
5:53.618 Waiting 1.575 sec 13.0/100: 13% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:55.193 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:56.198 Waiting 1.890 sec 11.7/100: 12% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:58.088 potion Fluffy_Pillow 32.8/100: 33% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:58.088 Waiting 0.700 sec 32.8/100: 33% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
5:58.788 shred Fluffy_Pillow 40.6/100: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
5:59.794 Waiting 2.588 sec 11.8/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:02.382 shred Fluffy_Pillow 40.6/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points savage_roar, potion_of_the_old_war
6:04.153 wild_charge Fluffy_Pillow 20.3/100: 20% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, potion_of_the_old_war
6:04.153 Waiting 0.422 sec 20.3/100: 20% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, wild_charge_movement, potion_of_the_old_war
6:04.575 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points potion_of_the_old_war
6:04.830 ferocious_bite Fluffy_Pillow 27.8/100: 28% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points potion_of_the_old_war
6:06.853 tigers_fury Fluffy_Pillow 22.5/100: 23% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, potion_of_the_old_war
6:06.969 berserk Fluffy_Pillow 43.8/100: 44% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:06.969 rake Fluffy_Pillow 43.8/150: 29% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points feral_instinct, ashamanes_energy, berserk, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:07.976 lunar_inspiration Fluffy_Pillow 57.5/150: 38% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, ashamanes_energy, berserk, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:08.981 shred Fluffy_Pillow 73.7/150: 49% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points feral_instinct, ashamanes_energy, berserk, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:09.986 shred Fluffy_Pillow 84.9/150: 57% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points feral_instinct, berserk, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:10.990 savage_roar Fluffy_Pillow 76.1/150: 51% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points feral_instinct, berserk, predatory_swiftness, tigers_fury, potion_of_the_old_war
6:11.993 skull_bash Fluffy_Pillow 67.2/150: 45% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:11.993 shred Fluffy_Pillow 67.2/150: 45% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:12.997 shred Fluffy_Pillow 58.4/150: 39% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:14.000 shred Fluffy_Pillow 49.6/150: 33% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:15.005 ferocious_bite Fluffy_Pillow 60.8/150: 41% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, feral_instinct, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:16.010 shred Fluffy_Pillow 59.5/150: 40% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:17.015 shred Fluffy_Pillow 50.6/150: 34% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:18.018 rake Fluffy_Pillow 41.8/150: 28% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:19.020 ferocious_bite Fluffy_Pillow 35.5/150: 24% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:20.025 wild_charge Fluffy_Pillow 21.7/150: 14% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, feral_instinct, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:20.025 lunar_inspiration Fluffy_Pillow 21.7/150: 14% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, wild_charge_movement, feral_instinct, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:20.225 auto_attack Fluffy_Pillow 6.7/150: 4% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:21.029 Waiting 0.644 sec 17.8/150: 12% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:21.673 shred Fluffy_Pillow 25.0/150: 17% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:22.678 Waiting 2.191 sec 16.2/100: 16% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:24.869 shred Fluffy_Pillow 40.6/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:25.873 Waiting 2.490 sec 11.8/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:28.363 savage_roar Fluffy_Pillow 39.5/100: 39% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
6:29.369 rake Fluffy_Pillow 50.7/100: 51% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
6:30.374 Waiting 1.200 sec 26.9/100: 27% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
6:31.574 shred Fluffy_Pillow 40.2/100: 40% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 25400 23693 13538 (11984)
Stamina 36167 36167 21625
Intellect 7651 7326 0
Spirit 0 0 0
Health 2170020 2170020 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 30480 28432 0
Crit 40.46% 40.46% 8911
Haste 11.32% 11.32% 3679
Damage / Heal Versatility 3.30% 3.30% 1319
Attack Power 25400 23693 0
Mastery 57.16% 55.02% 6827
Armor 2145 2145 2145
Run Speed 10 0 0
Leech 1.76% 1.76% 404

Gear

Source Slot Average Item Level: 862.00
Local Head Biornskin Hood
ilevel: 865, stats: { 281 Armor, +1491 AgiInt, +2237 Sta, +809 Crit, +571 Mastery }
Local Neck Pendant of the Stormforger
ilevel: 845, stats: { +1045 Sta, +1132 Crit, +669 Haste }, gems: { +150 Crit }
Local Shoulders Otherworldy Leather Mantle
ilevel: 865, stats: { 259 Armor, +1678 Sta, +1119 AgiInt, +628 Crit, +407 Mastery }
Local Chest Ekowraith, Creator of Worlds
ilevel: 895, stats: { 382 Armor, +2959 Sta, +1973 AgiInt, +552 Crit, +993 Mastery }
Local Waist Swordsinger's Belt
ilevel: 865, stats: { 195 Armor, +1119 AgiInt, +1678 Sta, +628 Mastery, +407 Haste, +638 unknown }
Local Legs Felbat Leather Leggings
ilevel: 850, stats: { 288 Armor, +1297 AgiInt, +1945 Sta, +792 Crit, +512 Vers }
Local Feet Mana-Tanned Sandals
ilevel: 875, stats: { 246 Armor, +1842 Sta, +1228 AgiInt, +744 Mastery, +330 Crit }
Local Wrists Wax-Sealed Leather Bracers
ilevel: 860, stats: { 149 Armor, +1201 Sta, +801 AgiInt, +545 Haste, +218 Crit }
Local Hands Gravelworn Handguards
ilevel: 860, stats: { 213 Armor, +1068 AgiInt, +1601 Sta, +638 Haste, +377 Crit }
Local Finger1 Signet of the Highborne Magi
ilevel: 850, stats: { +1094 Sta, +1154 Mastery, +682 Crit }
Local Finger2 Rough-Hammered Silver Ring
ilevel: 850, stats: { +1094 Sta, +1206 Crit, +629 Mastery }, enchant: { +150 Crit }
Local Trinket1 Chrono Shard
ilevel: 840, stats: { +1123 StrAgiInt, +404 Leech }
Local Trinket2 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Back Stormsky Greatcloak
ilevel: 855, stats: { 132 Armor, +765 StrAgiInt, +1147 Sta, +454 Crit, +294 Mastery }, enchant: { +150 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 875, weapon: { 2879 - 5349, 1.8 }, stats: { +702 Agi, +1052 Sta, +312 Crit, +300 Mastery }, relics: { +40 ilevels, +42 ilevels, +43 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 875, weapon: { 2879 - 5349, 1.8 }, stats: { +702 Agi, +1052 Sta, +312 Crit, +300 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="Oinkie"
origin="https://us.api.battle.net/wow/character/thrall/Oinkie/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/231/133784295-avatar.jpg"
level=110
race=tauren
role=attack
position=back
professions=inscription=714/herbalism=815
talents=3311322
artifact=58:0:0:0:0:1153:1:1154:1:1156:1:1157:1:1158:1:1161:3:1162:3:1163:3:1164:3:1165:3:1166:3:1167:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener=tigers_fury,if=!dot.rip.ticking&combo_points=5

head=biornskin_hood,id=134196,bonus_id=3414/1527/3336
neck=pendant_of_the_stormforger,id=133767,bonus_id=3411/1808/1497/1813,gems=150crit
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1805/1487
back=stormsky_greatcloak,id=134202,bonus_id=3473/1517/3337,enchant=150agi
chest=ekowraith_creator_of_worlds,id=137015,bonus_id=1811
wrists=waxsealed_leather_bracers,id=141429,bonus_id=3466/1472
hands=gravelworn_handguards,id=134443,bonus_id=3412/1512/3336
waist=swordsingers_belt,id=134287,bonus_id=3413/43/1527/3337
legs=felbat_leather_leggings,id=134370,bonus_id=1727/1512/3336
feet=manatanned_sandals,id=141430,bonus_id=1487/3337
finger1=signet_of_the_highborne_magi,id=134537,bonus_id=3411/1808/1502/3336
finger2=roughhammered_silver_ring,id=134191,bonus_id=3432/1512/3337,enchant=150crit
trinket1=chrono_shard,id=137419,bonus_id=1727/41/1492/1813
trinket2=unstable_arcanocrystal,id=141482,bonus_id=1472
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/133687/139249/0,relic_id=1727:1492:1813/1727:1497:3336/1807:1472/0
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=861.56
# gear_agility=13538
# gear_stamina=21625
# gear_crit_rating=8911
# gear_haste_rating=3066
# gear_mastery_rating=6827
# gear_versatility_rating=1319
# gear_leech_rating=404
# gear_armor=2145

Rothlandra

Rothlandra : 431852 dps, 260503 dps to main target

  • Race: Blood Elf
  • Class: Hunter
  • Spec: Marksmanship
  • Level: 110
  • Role: Attack
  • Position: ranged_back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
431852.1 431852.1 594.9 / 0.138% 116225.1 / 26.9% 24035.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
17.8 17.8 Focus 12.51% 39.1 100.0% 95%
Origin https://us.api.battle.net/wow/character/thrall/Rothlandra/advanced
Talents
  • 15: Lone Wolf (Marksmanship Hunter)
  • 30: Lock and Load (Marksmanship Hunter)
  • 45: Posthaste
  • 60: Patient Sniper (Marksmanship Hunter)
  • 75: Binding Shot
  • 90: Barrage
  • 100: Sidewinders (Marksmanship Hunter)
  • Talent Calculator
Artifact
Professions
  • mining: 257
  • herbalism: 291
Scale Factors for Rothlandra Damage Per Second
Mastery Agi Haste Vers Crit
Scale Factors 14.47 11.79 11.40 10.62 10.57
Normalized 1.23 1.00 0.97 0.90 0.90
Scale Deltas 1138 1138 1138 1138 1138
Error 0.76 0.75 0.74 0.75 0.75
Gear Ranking
Optimizers
Ranking
  • Mastery > Agi ~= Haste > Vers ~= Crit
Pawn string ( Pawn: v1: "Rothlandra": Agility=11.79, CritRating=10.57, HasteRating=11.40, MasteryRating=14.47, Versatility=10.62 )

Scale Factors for other metrics

Scale Factors for Rothlandra Damage Per Second
Mastery Agi Haste Vers Crit
Scale Factors 14.47 11.79 11.40 10.62 10.57
Normalized 1.23 1.00 0.97 0.90 0.90
Scale Deltas 1138 1138 1138 1138 1138
Error 0.76 0.75 0.74 0.75 0.75
Gear Ranking
Optimizers
Ranking
  • Mastery > Agi ~= Haste > Vers ~= Crit
Pawn string ( Pawn: v1: "Rothlandra": Agility=11.79, CritRating=10.57, HasteRating=11.40, MasteryRating=14.47, Versatility=10.62 )
Scale Factors for Rothlandra Priority Target Damage Per Second
Mastery Haste Agi Crit Vers
Scale Factors 8.89 8.22 6.73 6.30 6.21
Normalized 1.32 1.22 1.00 0.94 0.92
Scale Deltas 1138 1138 1138 1138 1138
Error 0.25 0.25 0.25 0.25 0.25
Gear Ranking
Optimizers
Ranking
  • Mastery > Haste > Agi > Crit ~= Vers
Pawn string ( Pawn: v1: "Rothlandra": Agility=6.73, CritRating=6.30, HasteRating=8.22, MasteryRating=8.89, Versatility=6.21 )
Scale Factors for Rothlandra Damage Per Second (Effective)
Mastery Agi Haste Vers Crit
Scale Factors 14.47 11.79 11.40 10.62 10.57
Normalized 1.23 1.00 0.97 0.90 0.90
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Mastery > Agi > Haste > Vers > Crit
Pawn string ( Pawn: v1: "Rothlandra": Agility=11.79, CritRating=10.57, HasteRating=11.40, MasteryRating=14.47, Versatility=10.62 )
Scale Factors for Rothlandra Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for RothlandraTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Rothlandra 431852
Aimed Shot 103119 (120967) 24.0% (28.2%) 116.3 3.43sec 416946 279743 Direct 116.2 231372 552325 355785 38.8%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.27 116.16 0.00 0.00 1.4905 0.0000 41327836.50 60755834.34 31.98 279743.00 279743.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.13 61.24% 231372.00 100773 251934 231241.29 206300 251934 16458333 24195308 31.98
crit 45.03 38.76% 552324.62 211624 806188 551997.86 444084 639912 24869504 36560526 31.98
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals ${$sw1*$<mult>} Physical damage.{$?s19434=true}[][ Replaces Cobra Shot.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.04
 
    Legacy of the Windrunners 17848 4.2% 0.0 0.00sec 0 0 Direct 104.2 44623 107115 68619 38.4%  

Stats details: legacy_of_the_windrunners

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 104.23 0.00 0.00 0.0000 0.0000 7152463.89 10514799.42 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.21 61.60% 44622.94 19760 49399 44632.81 30874 49399 2865205 4212123 31.98
crit 40.02 38.40% 107114.97 41495 158076 106913.08 60314 143988 4287259 6302676 31.98
 
 

Action details: legacy_of_the_windrunners

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190852
  • name:Legacy of the Windrunners
  • school:physical
  • tooltip:
  • description:Aimed Shot has a chance to coalesce {$s1=6} extra Wind Arrows that also shoot your target.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.40
 
auto_shot 15067 3.5% 163.7 2.45sec 36853 15097 Direct 163.7 26765 58683 36853 31.6%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 163.68 163.68 0.00 0.00 2.4411 0.0000 6031928.90 8867506.84 31.98 15096.58 15096.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.95 68.40% 26765.48 26765 26765 26765.48 26765 26765 2996382 4404966 31.98
crit 51.73 31.60% 58683.46 53531 80296 58677.17 54100 64512 3035547 4462541 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Barrage 79533 18.4% 19.3 21.26sec 1634794 667483 Periodic 1036.1 22494 49159 30476 29.9% 10.6%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.31 0.00 294.65 1036.11 2.4492 0.1441 31575934.80 46419615.11 31.98 667482.66 667482.66
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 726.0 70.07% 22493.65 17642 35285 22483.41 21333 24088 16329593 24006049 31.98
crit 310.1 29.93% 49159.32 35285 105854 49180.50 42087 56979 15246341 22413566 31.98
 
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.down
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
Deadly Grace 8902 2.0% 32.6 3.40sec 107993 0 Direct 32.4 79979 188607 108417 26.2%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.56 32.43 0.00 0.00 0.0000 0.0000 3515978.27 3515978.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.94 73.82% 79978.59 79979 79979 79978.59 79979 79979 1914775 1914775 0.00
crit 8.49 26.18% 188607.19 159957 239936 188464.56 159957 239936 1601203 1601203 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Marked Shot 128182 29.5% 36.9 10.88sec 1375231 1218192 Direct 119.5 301950 652188 424866 35.1%  

Stats details: marked_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.92 119.49 0.00 0.00 1.1289 0.0000 50766924.63 74632187.99 31.98 1218191.79 1218191.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.55 64.90% 301949.92 121292 303229 301954.80 286019 303229 23417590 34426075 31.98
crit 41.93 35.10% 652187.56 242583 909687 652303.46 576913 741226 27349335 40206113 31.98
 
 

Action details: marked_shot

Static Values
  • id:185901
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
Spelldata
  • id:185901
  • name:Marked Shot
  • school:physical
  • tooltip:
  • description:Rapidly fires shots at all targets with your Hunter's Mark, dealing $212621sw2 Physical damage and making them Vulnerable for {$187131d=30 seconds}. |Tinterface\icons\ability_hunter_mastermarksman.blp:24|t |cFFFFFFFFVulnerable|r {$@spelldesc187131=Damage taken from Marked Shot and Aimed Shot increased by {$s2=50}% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
Pepper Breath 4187 1.0% 20.1 19.78sec 83264 0 Periodic 98.8 16973 0 16973 0.0% 6.2%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.13 0.00 100.05 98.76 0.0000 0.2497 1676295.09 1676295.09 0.00 67089.37 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 98.8 100.00% 16972.78 68 16990 16973.48 16658 16990 1676295 1676295 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Sidewinders 55143 12.7% 45.2 8.91sec 483580 425224 Direct 155.0 106625 227729 140893 28.3%  

Stats details: sidewinders

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.16 154.99 0.00 0.00 1.1373 0.0000 21837353.06 21837353.06 0.00 425223.50 425223.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.14 71.70% 106624.74 106625 106625 106624.74 106625 106625 11849828 11849828 0.00
crit 43.86 28.30% 227728.85 213249 319874 227705.20 213249 260410 9987525 9987525 0.00
 
 

Action details: sidewinders

Static Values
  • id:214579
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
Spelldata
  • id:214579
  • name:Sidewinders
  • school:nature
  • tooltip:
  • description:Launches Sidewinders that travel toward the target, weaving back and forth and dealing {$214581s1=0} Nature damage to each target they hit. Cannot hit the same target twice. Applies Vulnerable to all targets hit. |cFFFFFFFFGenerates {$s2=50} Focus.|r{$?s214579=false}[][ |cFFFFD200Also replaces Multi-Shot.|r]
 
Windburst 19872 4.6% 15.8 24.54sec 503813 400933 Direct 16.8 352848 742931 474798 31.3%  

Stats details: windburst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.80 16.76 0.00 0.00 1.2566 0.0000 7959324.95 11700961.61 31.98 400933.15 400933.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.52 68.74% 352848.31 352848 352848 352848.31 352848 352848 4066031 5977450 31.98
crit 5.24 31.26% 742930.66 705697 1058545 741376.16 0 1058545 3893294 5723511 31.90
 
 

Action details: windburst

Static Values
  • id:204147
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204147
  • name:Windburst
  • school:physical
  • tooltip:
  • description:Focuses the power of Wind through |cFFFFCC99Thas'dorah|r, dealing $sw1 Physical damage to your target, and leaving behind a trail of wind for {$204475d=5 seconds} that increases the movement speed of allies by {$204477s1=50}%.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.00
 
Simple Action Stats Execute Interval
Rothlandra
Arcane Torrent 4.8 91.02sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:80483
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
Spelldata
  • id:80483
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and restore {$s2=15} of your Focus. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rothlandra
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rothlandra
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Trueshot 3.6 134.53sec

Stats details: trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: trueshot

Static Values
  • id:193526
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:170.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
Spelldata
  • id:193526
  • name:Trueshot
  • school:physical
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 19.49% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bullseye 7.4 294.7 42.8sec 1.2sec 30.51% 30.51% 180.7(180.7) 6.4

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_bullseye
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01

Stack Uptimes

  • bullseye_1:0.16%
  • bullseye_2:0.17%
  • bullseye_3:0.15%
  • bullseye_4:0.14%
  • bullseye_5:4.50%
  • bullseye_6:0.13%
  • bullseye_7:0.12%
  • bullseye_8:0.12%
  • bullseye_9:0.12%
  • bullseye_10:3.05%
  • bullseye_11:0.11%
  • bullseye_12:0.11%
  • bullseye_13:0.11%
  • bullseye_14:0.10%
  • bullseye_15:0.38%
  • bullseye_16:0.10%
  • bullseye_17:0.09%
  • bullseye_18:0.09%
  • bullseye_19:0.10%
  • bullseye_20:0.38%
  • bullseye_21:0.10%
  • bullseye_22:0.10%
  • bullseye_23:0.11%
  • bullseye_24:0.11%
  • bullseye_25:0.41%
  • bullseye_26:0.11%
  • bullseye_27:0.11%
  • bullseye_28:0.11%
  • bullseye_29:0.11%
  • bullseye_30:19.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204090
  • name:Bullseye
  • tooltip:Critical strike chance increased by {$s1=1}%.
  • description:{$@spelldesc204089=When your abilities damage a target below {$s1=20}% health, you gain {$204090s1=1}% increased critical strike chance for {$204090d=6 seconds}, stacking up to {$204090u=30} times.}
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 12.5 0.6 30.4sec 28.9sec 8.54% 10.78% 0.6(0.8) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lock_and_load_1:4.41%
  • lock_and_load_2:4.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:$@spelldesc198811
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Marking Targets 35.6 13.6 11.3sec 8.2sec 41.11% 49.42% 13.6(13.6) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_marking_targets
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marking_targets_1:41.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:223138
  • name:Marking Targets
  • tooltip:Next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark.
  • description:Your next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark. Hunter's Mark activates Marked Shot.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 76.3sec 0.0sec 14.69% 14.69% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:14.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.53% 14.53% 2.0(2.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Rapid Killing 3.6 0.0 130.7sec 134.7sec 13.19% 15.50% 0.0(0.0) 3.5

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_rapid_killing
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • rapid_killing_1:13.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191342
  • name:Rapid Killing
  • tooltip:Critical damage increased by {$s1=50}%.
  • description:{$@spelldesc191339=Trueshot also increases your critical strike damage by {$191342s1=50}% for its duration.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Trueshot 3.6 0.0 130.7sec 134.7sec 13.19% 18.53% 0.0(0.0) 3.5

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_trueshot
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • trueshot_1:13.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193526
  • name:Trueshot
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rothlandra
aimed_shot Focus 116.3 4547.2 39.1 39.1 10661.7
barrage Focus 19.3 1158.9 60.0 60.0 27246.6
marked_shot Focus 36.9 1107.5 30.0 30.0 45841.0
windburst Focus 16.8 336.0 20.0 21.3 23690.9
Resource Gains Type Count Total Average Overflow
arcane_torrent Focus 4.84 71.77 (1.01%) 14.84 0.76 1.04%
sidewinders Focus 45.16 2113.29 (29.86%) 46.80 144.60 6.40%
focus_regen Focus 1433.87 4891.67 (69.12%) 3.41 407.55 7.69%
Resource RPS-Gain RPS-Loss
Focus 17.66 17.85
Combat End Resource Mean Min Max
Focus 76.78 5.13 150.00

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 6.2%

Procs

Count Interval
starved: barrage 107.0 5.2sec
lock_and_load 13.1 28.9sec
no_vuln_aimed_shot 11.1 28.1sec
no_vuln_marked_shot 5.6 55.6sec
marking_targets 49.3 8.2sec
wasted_marking_targets 13.6 27.6sec

Statistics & Data Analysis

Fight Length
Sample Data Rothlandra Fight Length
Count 9999
Mean 400.62
Minimum 307.54
Maximum 499.01
Spread ( max - min ) 191.47
Range [ ( max - min ) / 2 * 100% ] 23.90%
DPS
Sample Data Rothlandra Damage Per Second
Count 9999
Mean 431852.10
Minimum 347057.69
Maximum 537878.51
Spread ( max - min ) 190820.82
Range [ ( max - min ) / 2 * 100% ] 22.09%
Standard Deviation 30350.7629
5th Percentile 387717.93
95th Percentile 487031.21
( 95th Percentile - 5th Percentile ) 99313.28
Mean Distribution
Standard Deviation 303.5228
95.00% Confidence Intervall ( 431257.20 - 432446.99 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 189
0.1% Error 18974
0.1 Scale Factor Error with Delta=300 7863626
0.05 Scale Factor Error with Delta=300 31454507
0.01 Scale Factor Error with Delta=300 786362679
Priority Target DPS
Sample Data Rothlandra Priority Target Damage Per Second
Count 9999
Mean 260503.21
Minimum 226778.63
Maximum 301766.13
Spread ( max - min ) 74987.51
Range [ ( max - min ) / 2 * 100% ] 14.39%
Standard Deviation 10216.4757
5th Percentile 243883.27
95th Percentile 277797.81
( 95th Percentile - 5th Percentile ) 33914.54
Mean Distribution
Standard Deviation 102.1699
95.00% Confidence Intervall ( 260302.96 - 260703.46 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 59
0.1% Error 5908
0.1 Scale Factor Error with Delta=300 891016
0.05 Scale Factor Error with Delta=300 3564067
0.01 Scale Factor Error with Delta=300 89101677
DPS(e)
Sample Data Rothlandra Damage Per Second (Effective)
Count 9999
Mean 431852.10
Minimum 347057.69
Maximum 537878.51
Spread ( max - min ) 190820.82
Range [ ( max - min ) / 2 * 100% ] 22.09%
Damage
Sample Data Rothlandra Damage
Count 9999
Mean 171844040.10
Minimum 136837015.51
Maximum 212734111.28
Spread ( max - min ) 75897095.77
Range [ ( max - min ) / 2 * 100% ] 22.08%
DTPS
Sample Data Rothlandra Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rothlandra Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rothlandra Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rothlandra Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rothlandra Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rothlandra Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data RothlandraTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rothlandra Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
6 0.00 windburst
Default action list Executed every time the actor is available.
# count action,conditions
7 0.98 auto_shot
8 4.84 arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
0.00 blood_fury
0.00 berserking
9 0.02 auto_shot
0.00 variable,name=vulnerable_time,value=debuff.vulnerability.remains
A 0.00 call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
B 0.00 call_action_list,name=cooldowns
0.00 a_murder_of_crows,if=debuff.hunters_mark.down
C 0.00 call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
D 12.32 barrage,if=debuff.hunters_mark.down
0.00 black_arrow,if=debuff.hunters_mark.down
0.00 a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
E 6.07 barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
0.00 black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
0.00 piercing_shot,if=!talent.patient_sniper.enabled&focus>50
F 17.65 windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
G 0.03 windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
H 0.00 call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
I 11.82 sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
0.00 sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
J 0.50 marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
0.00 arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 explosive_shot
K 21.84 marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
L 34.12 aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
M 78.00 aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
N 9.50 marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
O 1.20 marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
P 29.62 sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
0.00 piercing_shot,if=talent.patient_sniper.enabled&focus>80
0.00 arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
0.00 multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
Q 9.07 aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
0.00 multishot,if=spell_targets.barrage>2
actions.cooldowns
# count action,conditions
R 1.00 potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
S 2.62 /trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
actions.open
# count action,conditions
0.00 a_murder_of_crows
T 0.95 trueshot
U 1.48 sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
V 3.10 marked_shot
W 1.27 aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
0.00 black_arrow
X 0.93 barrage
Y 7.07 aimed_shot,if=execute_time<debuff.vulnerability.remains
Z 1.58 sidewinders
a 0.28 aimed_shot
0.00 arcane_shot
actions.targetdie
# count action,conditions
b 0.77 marked_shot
c 0.01 windburst
d 1.31 aimed_shot,if=execute_time<debuff.vulnerability.remains
e 0.66 sidewinders
f 0.19 aimed_shot
0.00 arcane_shot

Sample Sequence

04567TXYYUL8VYWYYaUZVYaYPMMFDPKMMMMPKMMMPKMMMDFMPLKMIKLMMDPFKMMMPLLKDPKFMMMQ8PKMMDPLRFKMQPKSMMMIEKMMFMMMQPKMLDPMFMMPMMLPDMFMMPKMMQ8DIMMPFLLLKMMDIMMMMFPLNMMPELKMIKMFMMPKDSMINMMQIKFMMDPKLMP8MMPFLEKIMMMQPKMFMDIKMMMQQLPLLFLDNPLLNPLLNFPELNMMMPLL8NMFPESLNILLLNdeb

Sample Sequence Table

time name target resources buffs
Pre flask Rothlandra 150.0/150: 100% focus
Pre potion Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
Pre augmentation Rothlandra 150.0/150: 100% focus potion_of_deadly_grace
0:00.000 windburst Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 trueshot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 barrage Fluffy_Pillow 130.0/150: 87% focus rapid_killing, trueshot, potion_of_deadly_grace
0:02.115 aimed_shot Fluffy_Pillow 112.1/150: 75% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.021 aimed_shot Fluffy_Pillow 82.2/150: 55% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.928 sidewinders Fluffy_Pillow 52.3/150: 35% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:04.683 aimed_shot Fluffy_Pillow 119.0/150: 79% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:05.590 arcane_torrent Fluffy_Pillow 89.1/150: 59% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:05.590 marked_shot Fluffy_Pillow 104.1/150: 69% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:06.344 aimed_shot Fluffy_Pillow 90.9/150: 61% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:07.252 aimed_shot Fluffy_Pillow 111.0/150: 74% focus bloodlust, lock_and_load, rapid_killing, trueshot, potion_of_deadly_grace
0:08.006 aimed_shot Fluffy_Pillow 127.7/150: 85% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:08.913 aimed_shot Fluffy_Pillow 97.8/150: 65% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:09.818 aimed_shot Fluffy_Pillow 67.9/150: 45% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:10.725 sidewinders Fluffy_Pillow 38.0/150: 25% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:11.479 sidewinders Fluffy_Pillow 104.7/150: 70% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:12.234 marked_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, raid_movement, rapid_killing, trueshot, potion_of_deadly_grace
0:12.987 Waiting 0.200 sec 136.7/150: 91% focus bloodlust, raid_movement, rapid_killing, trueshot, potion_of_deadly_grace
0:13.187 aimed_shot Fluffy_Pillow 141.1/150: 94% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:14.094 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:15.000 aimed_shot Fluffy_Pillow 70.2/150: 47% focus bloodlust, potion_of_deadly_grace
0:16.266 Waiting 0.100 sec 40.2/150: 27% focus bloodlust, potion_of_deadly_grace
0:16.366 sidewinders Fluffy_Pillow 41.8/150: 28% focus bloodlust, potion_of_deadly_grace
0:17.317 aimed_shot Fluffy_Pillow 106.9/150: 71% focus bloodlust, potion_of_deadly_grace
0:18.583 aimed_shot Fluffy_Pillow 76.9/150: 51% focus bloodlust, potion_of_deadly_grace
0:19.849 Waiting 0.100 sec 47.0/150: 31% focus bloodlust, potion_of_deadly_grace
0:19.949 windburst Fluffy_Pillow 48.6/150: 32% focus bloodlust, potion_of_deadly_grace
0:20.952 Waiting 1.000 sec 44.5/150: 30% focus bloodlust, raid_movement, potion_of_deadly_grace
0:21.952 barrage Fluffy_Pillow 60.3/150: 40% focus bloodlust, raid_movement, potion_of_deadly_grace
0:24.121 Waiting 0.300 sec 34.6/150: 23% focus bloodlust, potion_of_deadly_grace
0:24.421 sidewinders Fluffy_Pillow 39.4/150: 26% focus bloodlust, marking_targets, potion_of_deadly_grace
0:25.374 marked_shot Fluffy_Pillow 104.5/150: 70% focus bloodlust, potion_of_deadly_grace
0:26.326 aimed_shot Fluffy_Pillow 89.6/150: 60% focus bloodlust, lock_and_load(2), potion_of_deadly_grace
0:27.278 aimed_shot Fluffy_Pillow 104.6/150: 70% focus bloodlust, lock_and_load, potion_of_deadly_grace
0:28.230 Waiting 1.000 sec 119.7/150: 80% focus bloodlust, raid_movement, lock_and_load(2), marking_targets
0:29.230 aimed_shot Fluffy_Pillow 135.5/150: 90% focus bloodlust, lock_and_load(2), marking_targets
0:30.182 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, lock_and_load, marking_targets
0:31.134 sidewinders Fluffy_Pillow 150.0/150: 100% focus bloodlust, marking_targets
0:32.088 marked_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust
0:33.039 aimed_shot Fluffy_Pillow 135.1/150: 90% focus bloodlust
0:34.305 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bloodlust
0:35.572 aimed_shot Fluffy_Pillow 70.1/150: 47% focus bloodlust
0:36.838 sidewinders Fluffy_Pillow 40.2/150: 27% focus bloodlust, marking_targets
0:37.790 marked_shot Fluffy_Pillow 105.3/150: 70% focus bloodlust, bullseye(5), lock_and_load(2)
0:38.741 aimed_shot Fluffy_Pillow 90.3/150: 60% focus bloodlust, bullseye(10), lock_and_load(2)
0:39.693 aimed_shot Fluffy_Pillow 105.4/150: 70% focus bloodlust, bullseye(10), lock_and_load
0:40.644 aimed_shot Fluffy_Pillow 120.4/150: 80% focus bloodlust, bullseye(10)
0:41.910 barrage Fluffy_Pillow 85.9/150: 57% focus bullseye(10)
0:44.573 Waiting 0.600 sec 58.3/150: 39% focus raid_movement
0:45.173 windburst Fluffy_Pillow 65.6/150: 44% focus
0:46.406 aimed_shot Fluffy_Pillow 60.6/150: 40% focus
0:48.050 sidewinders Fluffy_Pillow 30.7/150: 20% focus marking_targets
0:49.284 aimed_shot Fluffy_Pillow 95.7/150: 64% focus
0:50.518 marked_shot Fluffy_Pillow 110.7/150: 74% focus raid_movement, marking_targets
0:51.753 Waiting 1.900 sec 95.8/150: 64% focus raid_movement, marking_targets
0:53.653 aimed_shot Fluffy_Pillow 118.9/150: 79% focus marking_targets
0:55.299 Waiting 0.400 sec 89.0/150: 59% focus marking_targets
0:55.699 sidewinders Fluffy_Pillow 93.8/150: 63% focus marking_targets
0:56.935 marked_shot Fluffy_Pillow 150.0/150: 100% focus
0:58.171 aimed_shot Fluffy_Pillow 135.1/150: 90% focus marking_targets
0:59.816 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets
1:01.050 Waiting 0.100 sec 115.1/150: 77% focus raid_movement, marking_targets
1:01.150 aimed_shot Fluffy_Pillow 116.3/150: 78% focus marking_targets
1:02.796 barrage Fluffy_Pillow 86.3/150: 58% focus marking_targets
1:05.498 sidewinders Fluffy_Pillow 59.3/150: 40% focus marking_targets
1:06.734 windburst Fluffy_Pillow 124.3/150: 83% focus
1:07.969 marked_shot Fluffy_Pillow 119.4/150: 80% focus
1:09.204 aimed_shot Fluffy_Pillow 104.4/150: 70% focus bullseye(5)
1:10.850 aimed_shot Fluffy_Pillow 74.5/150: 50% focus bullseye(5), marking_targets
1:12.496 Waiting 0.900 sec 44.5/150: 30% focus bullseye(5), marking_targets
1:13.396 aimed_shot Fluffy_Pillow 55.5/150: 37% focus bullseye(5), marking_targets
1:15.041 sidewinders Fluffy_Pillow 25.5/150: 17% focus marking_targets
1:16.277 Waiting 0.900 sec 90.6/150: 60% focus raid_movement
1:17.177 aimed_shot Fluffy_Pillow 101.5/150: 68% focus
1:18.825 aimed_shot Fluffy_Pillow 71.6/150: 48% focus marking_targets
1:20.060 marked_shot Fluffy_Pillow 86.6/150: 58% focus raid_movement, marking_targets
1:21.296 Waiting 1.300 sec 71.7/150: 48% focus raid_movement, marking_targets
1:22.596 barrage Fluffy_Pillow 87.5/150: 58% focus raid_movement, marking_targets
1:25.514 sidewinders Fluffy_Pillow 63.1/150: 42% focus marking_targets
1:26.750 marked_shot Fluffy_Pillow 128.1/150: 85% focus
1:27.985 windburst Fluffy_Pillow 113.2/150: 75% focus
1:29.220 aimed_shot Fluffy_Pillow 108.2/150: 72% focus
1:30.867 aimed_shot Fluffy_Pillow 78.3/150: 52% focus
1:32.103 Waiting 1.100 sec 93.3/150: 62% focus raid_movement
1:33.203 aimed_shot Fluffy_Pillow 106.7/150: 71% focus
1:34.850 Waiting 0.400 sec 76.8/150: 51% focus
1:35.250 aimed_shot Fluffy_Pillow 81.7/150: 54% focus
1:36.897 arcane_torrent Fluffy_Pillow 51.7/150: 34% focus marking_targets
1:36.897 sidewinders Fluffy_Pillow 66.7/150: 44% focus marking_targets
1:38.134 marked_shot Fluffy_Pillow 131.8/150: 88% focus bullseye(5)
1:39.371 aimed_shot Fluffy_Pillow 116.9/150: 78% focus bullseye(10)
1:41.016 aimed_shot Fluffy_Pillow 86.9/150: 58% focus bullseye(10), marking_targets
1:42.662 Waiting 0.300 sec 57.0/150: 38% focus bullseye(10), marking_targets
1:42.962 barrage Fluffy_Pillow 60.6/150: 40% focus bullseye(10), marking_targets
1:45.623 sidewinders Fluffy_Pillow 33.0/150: 22% focus marking_targets
1:46.859 aimed_shot Fluffy_Pillow 98.1/150: 65% focus lock_and_load(2), marking_targets
1:48.095 potion Fluffy_Pillow 113.1/150: 75% focus raid_movement, lock_and_load, marking_targets
1:48.095 Waiting 1.100 sec 113.1/150: 75% focus raid_movement, lock_and_load, marking_targets, potion_of_deadly_grace
1:49.195 windburst Fluffy_Pillow 126.5/150: 84% focus lock_and_load, marking_targets, potion_of_deadly_grace
1:50.451 marked_shot Fluffy_Pillow 141.8/150: 95% focus raid_movement, lock_and_load, marking_targets, potion_of_deadly_grace
1:51.687 Waiting 1.900 sec 126.9/150: 85% focus raid_movement, lock_and_load, marking_targets, potion_of_deadly_grace
1:53.587 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets, potion_of_deadly_grace
1:54.823 Waiting 0.300 sec 150.0/150: 100% focus marking_targets, potion_of_deadly_grace
1:55.123 aimed_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets, potion_of_deadly_grace
1:56.770 sidewinders Fluffy_Pillow 100.1/150: 67% focus marking_targets, potion_of_deadly_grace
1:58.008 marked_shot Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
1:59.244 trueshot Fluffy_Pillow 135.1/150: 90% focus potion_of_deadly_grace
1:59.244 aimed_shot Fluffy_Pillow 135.1/150: 90% focus rapid_killing, trueshot, potion_of_deadly_grace
2:00.422 aimed_shot Fluffy_Pillow 100.1/150: 67% focus rapid_killing, trueshot, potion_of_deadly_grace
2:01.598 aimed_shot Fluffy_Pillow 70.2/150: 47% focus marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
2:02.777 Waiting 1.100 sec 40.3/150: 27% focus marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
2:03.877 sidewinders Fluffy_Pillow 59.0/150: 39% focus marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
2:04.957 barrage Fluffy_Pillow 127.4/150: 85% focus raid_movement, rapid_killing, trueshot, potion_of_deadly_grace
2:07.011 marked_shot Fluffy_Pillow 102.5/150: 68% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
2:07.897 aimed_shot Fluffy_Pillow 87.6/150: 58% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
2:09.072 aimed_shot Fluffy_Pillow 57.6/150: 38% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
2:10.247 windburst Fluffy_Pillow 27.7/150: 18% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
2:11.131 Waiting 1.400 sec 22.7/150: 15% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
2:12.531 aimed_shot Fluffy_Pillow 46.6/150: 31% focus bullseye(30), lock_and_load(2), rapid_killing, trueshot, potion_of_deadly_grace
2:13.416 aimed_shot Fluffy_Pillow 61.7/150: 41% focus lock_and_load, rapid_killing, trueshot, potion_of_deadly_grace
2:14.300 aimed_shot Fluffy_Pillow 76.5/150: 51% focus potion_of_deadly_grace
2:15.944 Waiting 0.800 sec 46.5/150: 31% focus potion_of_deadly_grace
2:16.744 aimed_shot Fluffy_Pillow 56.3/150: 38% focus potion_of_deadly_grace
2:18.390 Waiting 0.800 sec 26.3/150: 18% focus
2:19.190 sidewinders Fluffy_Pillow 36.1/150: 24% focus marking_targets
2:20.424 marked_shot Fluffy_Pillow 101.1/150: 67% focus raid_movement
2:21.659 aimed_shot Fluffy_Pillow 86.1/150: 57% focus
2:23.304 aimed_shot Fluffy_Pillow 56.2/150: 37% focus
2:24.950 barrage Fluffy_Pillow 76.2/150: 51% focus lock_and_load
2:27.712 Waiting 1.300 sec 49.9/150: 33% focus lock_and_load
2:29.012 sidewinders Fluffy_Pillow 65.7/150: 44% focus lock_and_load
2:30.246 aimed_shot Fluffy_Pillow 130.7/150: 87% focus lock_and_load
2:31.480 windburst Fluffy_Pillow 145.8/150: 97% focus
2:32.715 aimed_shot Fluffy_Pillow 130.0/150: 87% focus
2:34.362 aimed_shot Fluffy_Pillow 100.1/150: 67% focus
2:36.007 Waiting 1.800 sec 120.1/150: 80% focus raid_movement
2:37.807 sidewinders Fluffy_Pillow 142.0/150: 95% focus
2:39.041 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(5)
2:40.686 aimed_shot Fluffy_Pillow 100.0/150: 67% focus bullseye(5)
2:42.332 Waiting 1.000 sec 70.1/150: 47% focus bullseye(5)
2:43.332 aimed_shot Fluffy_Pillow 82.3/150: 55% focus bullseye(5)
2:44.976 sidewinders Fluffy_Pillow 52.3/150: 35% focus
2:46.212 barrage Fluffy_Pillow 117.4/150: 78% focus marking_targets
2:48.939 aimed_shot Fluffy_Pillow 90.6/150: 60% focus marking_targets
2:50.174 Waiting 2.500 sec 105.6/150: 70% focus raid_movement, marking_targets
2:52.674 windburst Fluffy_Pillow 136.1/150: 91% focus marking_targets
2:53.947 aimed_shot Fluffy_Pillow 130.1/150: 87% focus marking_targets
2:55.594 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets
2:57.239 sidewinders Fluffy_Pillow 70.1/150: 47% focus marking_targets
2:58.475 marked_shot Fluffy_Pillow 135.2/150: 90% focus
2:59.711 aimed_shot Fluffy_Pillow 120.2/150: 80% focus
3:01.355 aimed_shot Fluffy_Pillow 90.2/150: 60% focus
3:03.001 Waiting 1.700 sec 60.3/150: 40% focus
3:04.701 aimed_shot Fluffy_Pillow 81.0/150: 54% focus
3:06.347 Waiting 0.300 sec 51.1/150: 34% focus
3:06.647 arcane_torrent Fluffy_Pillow 54.7/150: 36% focus
3:06.897 Waiting 0.100 sec 72.8/150: 49% focus
3:06.997 barrage Fluffy_Pillow 74.0/150: 49% focus
3:09.699 sidewinders Fluffy_Pillow 46.9/150: 31% focus bullseye(30)
3:10.935 aimed_shot Fluffy_Pillow 111.9/150: 75% focus bullseye(30), marking_targets
3:12.578 aimed_shot Fluffy_Pillow 82.0/150: 55% focus bullseye(30), marking_targets
3:14.224 sidewinders Fluffy_Pillow 52.0/150: 35% focus bullseye(30), marking_targets
3:15.458 windburst Fluffy_Pillow 117.0/150: 78% focus bullseye(30)
3:16.694 aimed_shot Fluffy_Pillow 112.1/150: 75% focus
3:18.340 aimed_shot Fluffy_Pillow 82.1/150: 55% focus
3:19.986 aimed_shot Fluffy_Pillow 52.2/150: 35% focus
3:21.222 marked_shot Fluffy_Pillow 67.3/150: 45% focus raid_movement
3:22.459 Waiting 1.200 sec 52.3/150: 35% focus raid_movement, lock_and_load(2)
3:23.659 aimed_shot Fluffy_Pillow 66.9/150: 45% focus lock_and_load(2)
3:24.893 Waiting 0.300 sec 82.0/150: 55% focus raid_movement, lock_and_load(2)
3:25.193 aimed_shot Fluffy_Pillow 85.6/150: 57% focus lock_and_load(2)
3:26.429 Waiting 0.400 sec 100.7/150: 67% focus lock_and_load
3:26.829 barrage Fluffy_Pillow 105.6/150: 70% focus lock_and_load
3:29.748 sidewinders Fluffy_Pillow 81.1/150: 54% focus lock_and_load
3:30.983 aimed_shot Fluffy_Pillow 146.2/150: 97% focus lock_and_load, marking_targets
3:32.217 aimed_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets
3:33.862 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets
3:35.507 aimed_shot Fluffy_Pillow 70.1/150: 47% focus marking_targets
3:37.153 windburst Fluffy_Pillow 40.1/150: 27% focus marking_targets
3:38.390 sidewinders Fluffy_Pillow 35.2/150: 23% focus marking_targets
3:39.627 aimed_shot Fluffy_Pillow 100.3/150: 67% focus bullseye(5)
3:40.862 Waiting 0.200 sec 115.3/150: 77% focus raid_movement, bullseye(5), marking_targets
3:41.062 marked_shot Fluffy_Pillow 117.8/150: 79% focus raid_movement, bullseye(5), marking_targets
3:42.298 aimed_shot Fluffy_Pillow 102.8/150: 69% focus bullseye(5), marking_targets
3:43.943 aimed_shot Fluffy_Pillow 72.8/150: 49% focus bullseye(5), marking_targets
3:45.588 sidewinders Fluffy_Pillow 42.9/150: 29% focus marking_targets
3:46.824 barrage Fluffy_Pillow 107.9/150: 72% focus
3:49.672 aimed_shot Fluffy_Pillow 82.6/150: 55% focus
3:50.908 marked_shot Fluffy_Pillow 97.7/150: 65% focus raid_movement, marking_targets
3:52.143 Waiting 1.500 sec 82.7/150: 55% focus raid_movement, marking_targets
3:53.643 aimed_shot Fluffy_Pillow 101.0/150: 67% focus marking_targets
3:55.288 sidewinders Fluffy_Pillow 71.0/150: 47% focus marking_targets
3:56.522 marked_shot Fluffy_Pillow 136.1/150: 91% focus raid_movement
3:57.757 aimed_shot Fluffy_Pillow 121.1/150: 81% focus
3:59.402 windburst Fluffy_Pillow 91.2/150: 61% focus
4:00.638 aimed_shot Fluffy_Pillow 86.2/150: 57% focus
4:02.283 aimed_shot Fluffy_Pillow 56.3/150: 38% focus
4:03.928 Waiting 0.900 sec 26.3/150: 18% focus
4:04.828 sidewinders Fluffy_Pillow 37.3/150: 25% focus marking_targets
4:06.063 marked_shot Fluffy_Pillow 102.3/150: 68% focus
4:07.299 barrage Fluffy_Pillow 87.4/150: 58% focus bullseye(5), marking_targets
4:10.039 trueshot Fluffy_Pillow 60.7/150: 40% focus bullseye(30), marking_targets
4:10.039 aimed_shot Fluffy_Pillow 60.7/150: 40% focus bullseye(30), marking_targets, rapid_killing, trueshot
4:11.218 sidewinders Fluffy_Pillow 30.8/150: 21% focus bullseye(30), marking_targets, rapid_killing, trueshot
4:12.102 marked_shot Fluffy_Pillow 95.9/150: 64% focus raid_movement, bullseye(30), rapid_killing, trueshot
4:12.987 Waiting 0.200 sec 81.0/150: 54% focus raid_movement, bullseye(30), rapid_killing, trueshot
4:13.187 aimed_shot Fluffy_Pillow 84.4/150: 56% focus bullseye(30), rapid_killing, trueshot
4:14.365 aimed_shot Fluffy_Pillow 54.5/150: 36% focus bullseye(30), marking_targets, rapid_killing, trueshot
4:15.542 Waiting 2.100 sec 24.6/150: 16% focus bullseye(30), marking_targets, rapid_killing, trueshot
4:17.642 aimed_shot Fluffy_Pillow 60.4/150: 40% focus marking_targets, rapid_killing, trueshot
4:18.818 Waiting 0.200 sec 30.4/150: 20% focus marking_targets, rapid_killing, trueshot
4:19.018 sidewinders Fluffy_Pillow 33.9/150: 23% focus marking_targets, rapid_killing, trueshot
4:20.057 marked_shot Fluffy_Pillow 101.6/150: 68% focus raid_movement, rapid_killing, trueshot
4:20.940 Waiting 2.700 sec 86.6/150: 58% focus raid_movement, rapid_killing, trueshot
4:23.640 windburst Fluffy_Pillow 132.7/150: 88% focus rapid_killing, trueshot
4:24.526 aimed_shot Fluffy_Pillow 127.8/150: 85% focus rapid_killing, trueshot
4:25.704 aimed_shot Fluffy_Pillow 94.6/150: 63% focus
4:27.350 barrage Fluffy_Pillow 64.7/150: 43% focus
4:30.116 Waiting 0.200 sec 38.4/150: 26% focus
4:30.316 sidewinders Fluffy_Pillow 40.8/150: 27% focus marking_targets
4:31.550 marked_shot Fluffy_Pillow 105.8/150: 71% focus
4:32.785 aimed_shot Fluffy_Pillow 90.9/150: 61% focus
4:34.430 aimed_shot Fluffy_Pillow 60.9/150: 41% focus
4:36.076 Waiting 0.500 sec 31.0/150: 21% focus
4:36.576 sidewinders Fluffy_Pillow 37.1/150: 25% focus
4:37.812 arcane_torrent Fluffy_Pillow 102.1/150: 68% focus bullseye(5)
4:37.812 aimed_shot Fluffy_Pillow 117.1/150: 78% focus bullseye(5)
4:39.457 aimed_shot Fluffy_Pillow 87.2/150: 58% focus bullseye(5)
4:41.102 Waiting 1.800 sec 57.2/150: 38% focus bullseye(5), marking_targets
4:42.902 sidewinders Fluffy_Pillow 79.1/150: 53% focus marking_targets
4:44.332 Waiting 0.900 sec 146.5/150: 98% focus raid_movement
4:45.232 windburst Fluffy_Pillow 150.0/150: 100% focus
4:46.467 aimed_shot Fluffy_Pillow 130.0/150: 87% focus
4:48.111 barrage Fluffy_Pillow 100.0/150: 67% focus
4:50.788 marked_shot Fluffy_Pillow 72.6/150: 48% focus raid_movement
4:52.023 Waiting 1.500 sec 57.7/150: 38% focus raid_movement
4:53.523 sidewinders Fluffy_Pillow 76.0/150: 51% focus raid_movement
4:54.759 aimed_shot Fluffy_Pillow 141.0/150: 94% focus marking_targets
4:56.405 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets
4:58.050 Waiting 0.400 sec 70.1/150: 47% focus marking_targets
4:58.450 aimed_shot Fluffy_Pillow 75.0/150: 50% focus marking_targets
5:00.006 Waiting 1.200 sec 93.9/150: 63% focus raid_movement, marking_targets
5:01.206 aimed_shot Fluffy_Pillow 108.5/150: 72% focus marking_targets
5:02.851 Waiting 0.100 sec 78.6/150: 52% focus marking_targets
5:02.951 sidewinders Fluffy_Pillow 79.8/150: 53% focus marking_targets
5:04.187 marked_shot Fluffy_Pillow 144.9/150: 97% focus marking_targets
5:05.422 aimed_shot Fluffy_Pillow 129.9/150: 87% focus marking_targets
5:07.068 windburst Fluffy_Pillow 99.9/150: 67% focus marking_targets
5:08.305 aimed_shot Fluffy_Pillow 95.0/150: 63% focus marking_targets
5:09.950 barrage Fluffy_Pillow 65.1/150: 43% focus marking_targets
5:12.654 sidewinders Fluffy_Pillow 38.0/150: 25% focus bullseye(5), marking_targets
5:13.889 marked_shot Fluffy_Pillow 103.0/150: 69% focus bullseye(5)
5:15.125 Waiting 0.100 sec 88.1/150: 59% focus bullseye(5)
5:15.225 aimed_shot Fluffy_Pillow 89.3/150: 60% focus bullseye(5)
5:16.461 Waiting 0.700 sec 104.4/150: 70% focus raid_movement, lock_and_load(2)
5:17.161 aimed_shot Fluffy_Pillow 112.9/150: 75% focus lock_and_load(2)
5:18.397 aimed_shot Fluffy_Pillow 128.0/150: 85% focus lock_and_load
5:19.634 Waiting 0.300 sec 143.0/150: 95% focus
5:19.934 aimed_shot Fluffy_Pillow 146.7/150: 98% focus
5:21.579 aimed_shot Fluffy_Pillow 100.0/150: 67% focus bullseye
5:23.224 aimed_shot Fluffy_Pillow 70.1/150: 47% focus bullseye(3), marking_targets
5:24.869 sidewinders Fluffy_Pillow 40.1/150: 27% focus bullseye(4), marking_targets
5:26.105 aimed_shot Fluffy_Pillow 105.2/150: 70% focus bullseye(13)
5:27.751 aimed_shot Fluffy_Pillow 75.2/150: 50% focus bullseye(14)
5:29.395 windburst Fluffy_Pillow 45.3/150: 30% focus bullseye(15)
5:30.631 Waiting 0.800 sec 40.3/150: 27% focus bullseye(23)
5:31.431 aimed_shot Fluffy_Pillow 50.1/150: 33% focus bullseye(24)
5:32.665 barrage Fluffy_Pillow 65.1/150: 43% focus raid_movement, bullseye(25)
5:35.382 Waiting 0.300 sec 38.2/150: 25% focus bullseye(30)
5:35.682 marked_shot Fluffy_Pillow 41.8/150: 28% focus bullseye(30), marking_targets
5:36.920 sidewinders Fluffy_Pillow 26.9/150: 18% focus bullseye(30), marking_targets
5:38.155 aimed_shot Fluffy_Pillow 92.0/150: 61% focus bullseye(30), marking_targets
5:39.800 aimed_shot Fluffy_Pillow 62.0/150: 41% focus bullseye(30), marking_targets
5:41.446 Waiting 0.500 sec 32.1/150: 21% focus bullseye(30), marking_targets
5:41.946 marked_shot Fluffy_Pillow 38.1/150: 25% focus bullseye(30), marking_targets
5:43.180 sidewinders Fluffy_Pillow 23.2/150: 15% focus bullseye(30), marking_targets
5:44.416 aimed_shot Fluffy_Pillow 88.2/150: 59% focus bullseye(30)
5:46.061 aimed_shot Fluffy_Pillow 58.3/150: 39% focus bullseye(30), marking_targets
5:47.708 Waiting 0.500 sec 28.3/150: 19% focus bullseye(30), marking_targets
5:48.208 marked_shot Fluffy_Pillow 34.4/150: 23% focus raid_movement, bullseye(30), marking_targets
5:49.445 Waiting 1.000 sec 19.5/150: 13% focus bullseye(30), marking_targets
5:50.445 windburst Fluffy_Pillow 31.7/150: 21% focus bullseye(30), marking_targets
5:51.861 sidewinders Fluffy_Pillow 28.9/150: 19% focus bullseye(30), marking_targets
5:53.286 barrage Fluffy_Pillow 96.3/150: 64% focus bullseye(30), marking_targets
5:56.012 Waiting 0.100 sec 69.5/150: 46% focus bullseye(30), marking_targets
5:56.112 aimed_shot Fluffy_Pillow 70.7/150: 47% focus bullseye(30), marking_targets
5:57.757 marked_shot Fluffy_Pillow 90.7/150: 60% focus bullseye(30), lock_and_load, marking_targets
5:58.993 aimed_shot Fluffy_Pillow 75.8/150: 51% focus bullseye(30), lock_and_load, marking_targets
6:00.230 aimed_shot Fluffy_Pillow 90.9/150: 61% focus bullseye(30), marking_targets
6:01.876 aimed_shot Fluffy_Pillow 60.9/150: 41% focus bullseye(30), marking_targets
6:03.522 sidewinders Fluffy_Pillow 31.0/150: 21% focus bullseye(30), marking_targets
6:04.759 Waiting 0.400 sec 96.0/150: 64% focus raid_movement, bullseye(30)
6:05.159 aimed_shot Fluffy_Pillow 100.9/150: 67% focus bullseye(30)
6:06.805 aimed_shot Fluffy_Pillow 71.0/150: 47% focus bullseye(30)
6:08.451 arcane_torrent Fluffy_Pillow 41.0/150: 27% focus bullseye(30)
6:08.451 Waiting 0.100 sec 56.0/150: 37% focus bullseye(30)
6:08.551 marked_shot Fluffy_Pillow 57.2/150: 38% focus bullseye(30)
6:09.786 Waiting 0.700 sec 42.3/150: 28% focus bullseye(30), marking_targets
6:10.486 aimed_shot Fluffy_Pillow 50.8/150: 34% focus bullseye(30), marking_targets
6:12.132 windburst Fluffy_Pillow 20.8/150: 14% focus bullseye(30), marking_targets
6:13.368 sidewinders Fluffy_Pillow 15.9/150: 11% focus bullseye(30), marking_targets
6:14.604 barrage Fluffy_Pillow 81.0/150: 54% focus bullseye(30), marking_targets
6:17.281 trueshot Fluffy_Pillow 53.6/150: 36% focus bullseye(30), marking_targets
6:17.281 aimed_shot Fluffy_Pillow 53.6/150: 36% focus bullseye(30), marking_targets, rapid_killing, trueshot
6:18.458 Waiting 0.400 sec 23.6/150: 16% focus bullseye(30), marking_targets, rapid_killing, trueshot
6:18.858 marked_shot Fluffy_Pillow 30.5/150: 20% focus bullseye(30), marking_targets, rapid_killing, trueshot
6:19.743 Waiting 1.700 sec 15.6/150: 10% focus bullseye(30), marking_targets, rapid_killing, trueshot
6:21.443 sidewinders Fluffy_Pillow 44.5/150: 30% focus bullseye(30), marking_targets, rapid_killing, trueshot
6:22.487 aimed_shot Fluffy_Pillow 112.3/150: 75% focus bullseye(30), rapid_killing, trueshot
6:23.664 aimed_shot Fluffy_Pillow 82.4/150: 55% focus bullseye(30), marking_targets, rapid_killing, trueshot
6:24.840 aimed_shot Fluffy_Pillow 52.5/150: 35% focus bullseye(30), marking_targets, rapid_killing, trueshot
6:26.018 Waiting 0.500 sec 22.6/150: 15% focus bullseye(30), marking_targets, rapid_killing, trueshot
6:26.518 marked_shot Fluffy_Pillow 31.1/150: 21% focus bullseye(30), marking_targets, rapid_killing, trueshot
6:27.404 Waiting 2.000 sec 16.2/150: 11% focus bullseye(30), marking_targets, rapid_killing, trueshot
6:29.404 aimed_shot Fluffy_Pillow 50.3/150: 34% focus bullseye(30), marking_targets, rapid_killing, trueshot
6:30.580 Waiting 0.700 sec 20.4/150: 14% focus bullseye(30), marking_targets, rapid_killing, trueshot
6:31.280 sidewinders Fluffy_Pillow 32.3/150: 22% focus bullseye(30), marking_targets, rapid_killing, trueshot
6:32.340 marked_shot Fluffy_Pillow 100.1/150: 67% focus bullseye(30)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6228 6228 0
Agility 26764 25399 15159 (10235)
Stamina 33399 33399 21344
Intellect 6009 6009 0
Spirit 2 2 0
Health 2003940 2003940 0
Focus 150 150 0
Crit 24.95% 24.95% 3133
Haste 21.81% 21.81% 7089
Damage / Heal Versatility 1.02% 1.02% 407
Attack Power 26764 25399 0
Mastery 18.23% 18.23% 7405
Armor 2579 2579 2579
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 863.00
Local Head Greyed Dragonscale Coif
ilevel: 855, stats: { 341 Armor, +2038 Sta, +1359 AgiInt, +751 Mastery, +579 Crit }
Local Neck Hatecoil Commander's Amulet
ilevel: 850, stats: { +1094 Sta, +1101 Haste, +734 Mastery }
Local Shoulders Arcane Exterminator's Shoulderguards
ilevel: 830, stats: { 292 Armor, +807 AgiInt, +1211 Sta, +649 Crit, +259 Haste }
Local Chest Bramblemail Hauberk
ilevel: 850, stats: { 414 Armor, +1297 AgiInt, +1945 Sta, +932 Haste, +372 Mastery }
Local Waist Belt of Mighty Links
ilevel: 865, stats: { 244 Armor, +1119 AgiInt, +1678 Sta, +673 Mastery, +362 Haste }
Local Legs Tempered Seaborne Leggings
ilevel: 850, stats: { 362 Armor, +1945 Sta, +1297 AgiInt, +820 Haste, +484 Crit }
Local Feet Ullr's Feather Snowshoes
ilevel: 895, stats: { 327 Armor, +2219 Sta, +1479 Agi, +662 Crit, +496 Mastery }
Local Wrists Assorted Dragonscale Bracers
ilevel: 870, stats: { 193 Armor, +1319 Sta, +879 AgiInt, +548 Haste, +242 Mastery }
Local Hands Gauntlets of Malevolent Intent
ilevel: 865, stats: { 271 Armor, +1678 Sta, +1119 AgiInt, +628 Haste, +407 Vers }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 850, stats: { +1094 Sta, +1311 Mastery, +525 Haste }, enchant: { +150 Mastery }
Local Finger2 Ring of Collapsing Futures
ilevel: 860, stats: { +1201 Sta, +1307 Mastery, +599 Haste }, enchant: { +150 Mastery }
Local Trinket1 Deteriorated Construct Core
ilevel: 875, stats: { +1557 AgiInt }
Local Trinket2 Three-Toed Rabbit Foot
ilevel: 880, stats: { +1631 Agi, +1043 Haste }
Local Back Drape of the Raven Lord
ilevel: 860, stats: { 135 Armor, +801 StrAgiInt, +1201 Sta, +490 Mastery, +272 Haste }
Local Main Hand Thas'dorah, Legacy of the Windrunners
ilevel: 886, weapon: { 9775 - 9777, 3 }, stats: { +1814 Agi, +2721 Sta, +759 Crit, +729 Mastery }, relics: { +45 ilevels, +43 ilevels, +48 ilevels }

Talents

Level
15 Lone Wolf (Marksmanship Hunter) Steady Focus (Marksmanship Hunter) Careful Aim (Marksmanship Hunter)
30 Lock and Load (Marksmanship Hunter) Black Arrow (Marksmanship Hunter) True Aim (Marksmanship Hunter)
45 Posthaste Farstrider Trailblazer
60 Explosive Shot (Marksmanship Hunter) Sentinel (Marksmanship Hunter) Patient Sniper (Marksmanship Hunter)
75 Binding Shot Wyvern Sting Camouflage (Marksmanship Hunter)
90 A Murder of Crows Barrage Volley
100 Sidewinders (Marksmanship Hunter) Piercing Shot (Marksmanship Hunter) Trick Shot (Marksmanship Hunter)

Profile

hunter="Rothlandra"
origin="https://us.api.battle.net/wow/character/thrall/Rothlandra/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/85/161015381-avatar.jpg"
level=110
race=blood_elf
role=attack
position=ranged_back
professions=mining=257/herbalism=291
talents=1113121
artifact=55:0:0:0:0:307:1:308:1:310:1:312:3:313:3:315:3:318:2:319:3:320:3:321:1:322:1:1337:1
spec=marksmanship

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/windburst

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
actions+=/blood_fury
actions+=/berserking
actions+=/auto_shot
actions+=/variable,name=vulnerable_time,value=debuff.vulnerability.remains
actions+=/call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
actions+=/call_action_list,name=cooldowns
actions+=/a_murder_of_crows,if=debuff.hunters_mark.down
actions+=/call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
actions+=/barrage,if=debuff.hunters_mark.down
actions+=/black_arrow,if=debuff.hunters_mark.down
actions+=/a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
actions+=/barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
actions+=/black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
actions+=/piercing_shot,if=!talent.patient_sniper.enabled&focus>50
actions+=/windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
actions+=/windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
actions+=/call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
actions+=/sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
actions+=/sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
actions+=/marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
actions+=/arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/explosive_shot
actions+=/marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
actions+=/aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
actions+=/aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
actions+=/marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
actions+=/marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
actions+=/sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
actions+=/piercing_shot,if=talent.patient_sniper.enabled&focus>80
actions+=/arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
actions+=/multishot,if=spell_targets.barrage>2

actions.cooldowns=potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
actions.cooldowns+=//trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16

actions.open=a_murder_of_crows
actions.open+=/trueshot
actions.open+=/sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
actions.open+=/marked_shot
actions.open+=/aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.open+=/black_arrow
actions.open+=/barrage
actions.open+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.open+=/sidewinders
actions.open+=/aimed_shot
actions.open+=/arcane_shot

actions.targetdie=marked_shot
actions.targetdie+=/windburst
actions.targetdie+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.targetdie+=/sidewinders
actions.targetdie+=/aimed_shot
actions.targetdie+=/arcane_shot

actions.trueshotaoe=marked_shot
actions.trueshotaoe+=/piercing_shot
actions.trueshotaoe+=/barrage
actions.trueshotaoe+=/explosive_shot
actions.trueshotaoe+=/aimed_shot,if=active_enemies=2&buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.trueshotaoe+=/multishot

head=greyed_dragonscale_coif,id=139214,bonus_id=1807/1477/3336
neck=hatecoil_commanders_amulet,id=134492,bonus_id=1727/1502/3336
shoulders=arcane_exterminators_shoulderguards,id=134472,bonus_id=1482
back=drape_of_the_raven_lord,id=136770,bonus_id=1727/1512/3337
chest=bramblemail_hauberk,id=139084,bonus_id=3474/1512/3336
wrists=assorted_dragonscale_bracers,id=141433,bonus_id=3466/1482/3336
hands=gauntlets_of_malevolent_intent,id=139213,bonus_id=1805/1487
waist=belt_of_mighty_links,id=137456,bonus_id=3413/1517/3337
legs=tempered_seaborne_leggings,id=133769,bonus_id=3410/1502/3336
feet=ullrs_feather_snowshoes,id=137033,bonus_id=1811/3458
finger1=archdruids_tainted_seal,id=134487,bonus_id=3410/1502/3336,enchant=150mastery
finger2=ring_of_collapsing_futures,id=142173,bonus_id=3453/1472,enchant=150mastery
trinket1=deteriorated_construct_core,id=142165,bonus_id=3453/1487/3337
trinket2=threetoed_rabbit_foot,id=134203,bonus_id=3474/604/1542/3337
main_hand=thasdorah_legacy_of_the_windrunners,id=128826,bonus_id=727,gem_id=142194/139260/141256/0,relic_id=3452:1472/1807:1472/3474:1527:3337/0

# Gear Summary
# gear_ilvl=862.73
# gear_agility=15159
# gear_stamina=21344
# gear_crit_rating=3133
# gear_haste_rating=7089
# gear_mastery_rating=7405
# gear_versatility_rating=407
# gear_armor=2579
summon_pet=cat

Sarkul

Sarkul : 461954 dps, 276686 dps to main target

  • Race: Orc
  • Class: Hunter
  • Spec: Marksmanship
  • Level: 110
  • Role: Attack
  • Position: ranged_back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
461953.6 461953.6 625.5 / 0.135% 119722.4 / 25.9% 28636.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
16.0 16.0 Focus 13.52% 35.5 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Sarkul/advanced
Talents
  • 15: Lone Wolf (Marksmanship Hunter)
  • 30: Lock and Load (Marksmanship Hunter)
  • 45: Trailblazer
  • 60: Patient Sniper (Marksmanship Hunter)
  • 75: Binding Shot
  • 90: Barrage
  • 100: Sidewinders (Marksmanship Hunter)
  • Talent Calculator
Artifact
Professions
  • leatherworking: 800
  • engineering: 709
Scale Factors for Sarkul Damage Per Second
Agi Mastery Vers Haste Crit
Scale Factors 13.15 12.65 11.61 11.54 11.21
Normalized 1.00 0.96 0.88 0.88 0.85
Scale Deltas 1138 1138 1138 1138 1138
Error 0.79 0.79 0.79 0.80 0.79
Gear Ranking
Optimizers
Ranking
  • Agi ~= Mastery > Vers ~= Haste ~= Crit
Pawn string ( Pawn: v1: "Sarkul": Agility=13.15, CritRating=11.21, HasteRating=11.54, MasteryRating=12.65, Versatility=11.61 )

Scale Factors for other metrics

Scale Factors for Sarkul Damage Per Second
Agi Mastery Vers Haste Crit
Scale Factors 13.15 12.65 11.61 11.54 11.21
Normalized 1.00 0.96 0.88 0.88 0.85
Scale Deltas 1138 1138 1138 1138 1138
Error 0.79 0.79 0.79 0.80 0.79
Gear Ranking
Optimizers
Ranking
  • Agi ~= Mastery > Vers ~= Haste ~= Crit
Pawn string ( Pawn: v1: "Sarkul": Agility=13.15, CritRating=11.21, HasteRating=11.54, MasteryRating=12.65, Versatility=11.61 )
Scale Factors for Sarkul Priority Target Damage Per Second
Haste Mastery Agi Crit Vers
Scale Factors 7.65 7.58 7.28 6.78 6.75
Normalized 1.05 1.04 1.00 0.93 0.93
Scale Deltas 1138 1138 1138 1138 1138
Error 0.26 0.26 0.26 0.26 0.26
Gear Ranking
Optimizers
Ranking
  • Haste ~= Mastery > Agi > Crit ~= Vers
Pawn string ( Pawn: v1: "Sarkul": Agility=7.28, CritRating=6.78, HasteRating=7.65, MasteryRating=7.58, Versatility=6.75 )
Scale Factors for Sarkul Damage Per Second (Effective)
Agi Mastery Vers Haste Crit
Scale Factors 13.15 12.65 11.61 11.54 11.21
Normalized 1.00 0.96 0.88 0.88 0.85
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Mastery > Vers > Haste > Crit
Pawn string ( Pawn: v1: "Sarkul": Agility=13.15, CritRating=11.21, HasteRating=11.54, MasteryRating=12.65, Versatility=11.61 )
Scale Factors for Sarkul Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for SarkulTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Sarkul 461954
Aimed Shot 98007 (114807) 21.4% (25.0%) 99.8 3.99sec 461271 286440 Direct 99.7 272049 639892 394149 33.2%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.79 99.69 0.00 0.00 1.6104 0.0000 39292225.71 57763293.66 31.98 286440.17 286440.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.60 66.81% 272048.82 112935 299648 271945.13 240748 286765 18118149 26635396 31.98
crit 33.09 33.19% 639891.79 237162 958874 639496.79 534604 749539 21174076 31127898 31.98
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals ${$sw1*$<mult>} Physical damage.{$?s19434=true}[][ Replaces Cobra Shot.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.04
 
    Legacy of the Windrunners 16800 3.7% 0.0 0.00sec 0 0 Direct 89.5 51832 123124 75281 32.9%  

Stats details: legacy_of_the_windrunners

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 89.54 0.00 0.00 0.0000 0.0000 6740141.83 9908646.94 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.09 67.11% 51831.99 22144 58755 51829.37 34169 57683 3114464 4578557 31.98
crit 29.45 32.89% 123124.17 46502 188014 122836.62 74404 172256 3625678 5330090 31.98
 
 

Action details: legacy_of_the_windrunners

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190852
  • name:Legacy of the Windrunners
  • school:physical
  • tooltip:
  • description:Aimed Shot has a chance to coalesce {$s1=6} extra Wind Arrows that also shoot your target.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.40
 
auto_shot 12503 2.7% 149.1 2.69sec 33571 12534 Direct 149.1 25379 55037 33571 27.6%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 149.13 149.13 0.00 0.00 2.6784 0.0000 5006335.36 7359787.19 31.98 12534.17 12534.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 107.93 72.38% 25378.76 25125 26698 25379.63 25242 25495 2739256 4026966 31.98
crit 41.19 27.62% 55036.88 50250 80094 55038.93 50528 60777 2267079 3332822 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Barrage 89642 19.4% 19.4 21.17sec 1831813 660027 Periodic 1088.4 25432 53724 32698 25.7% 12.2%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.43 0.00 309.81 1088.37 2.7754 0.1583 35588001.25 52317732.82 31.98 660027.10 660027.10
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 808.8 74.32% 25432.10 19771 41968 25418.06 24218 27082 20570403 30240441 31.98
crit 279.5 25.68% 53723.85 39543 125903 53776.99 47205 61376 15017598 22077292 31.98
 
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.down
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
Deadly Grace 8189 1.8% 30.4 6.39sec 106189 0 Direct 30.1 80707 191849 107256 23.9%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.35 30.05 0.00 0.00 0.0000 0.0000 3223048.74 3223048.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.87 76.11% 80706.98 80707 80707 80706.98 80707 80707 1845953 1845953 0.00
crit 7.18 23.89% 191848.93 161414 242121 190785.01 0 242121 1377096 1377096 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mark of the Hidden Satyr 3830 0.8% 23.0 17.30sec 66599 0 Direct 23.0 50459 109131 66598 27.5%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.02 23.02 0.00 0.00 0.0000 0.0000 1533140.00 1533140.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.69 72.49% 50459.06 50459 50459 50459.06 50459 50459 842054 842054 0.00
crit 6.33 27.51% 109130.93 100918 151377 108983.95 0 151377 691086 691086 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Marked Shot 138406 (149410) 29.8% (32.2%) 36.1 11.11sec 1639119 1341448 Direct 116.2 341734 714394 471729 34.9%  

Stats details: marked_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.10 116.23 0.00 0.00 1.2219 0.0000 54827663.91 80601859.36 31.98 1341448.49 1341448.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.69 65.12% 341734.39 135929 360658 341739.86 329503 346262 25864327 38023010 31.98
crit 40.54 34.88% 714394.04 271857 1081975 714613.19 659823 818959 28963337 42578849 31.98
 
 

Action details: marked_shot

Static Values
  • id:185901
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
Spelldata
  • id:185901
  • name:Marked Shot
  • school:physical
  • tooltip:
  • description:Rapidly fires shots at all targets with your Hunter's Mark, dealing $212621sw2 Physical damage and making them Vulnerable for {$187131d=30 seconds}. |Tinterface\icons\ability_hunter_mastermarksman.blp:24|t |cFFFFFFFFVulnerable|r {$@spelldesc187131=Damage taken from Marked Shot and Aimed Shot increased by {$s2=50}% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
    Call of the Hunter 11004 2.4% 14.6 51.66sec 297372 0 Direct 53.9 62590 132921 80655 25.7%  

Stats details: call_of_the_hunter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.62 53.90 0.00 0.00 0.0000 0.0000 4347653.26 6391462.12 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.06 74.31% 62589.50 61947 67453 62617.78 61947 67453 2507204 3685827 31.98
crit 13.85 25.69% 132921.30 123893 202358 133208.50 0 202358 1840449 2705635 31.97
 
 

Action details: call_of_the_hunter

Static Values
  • id:191070
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191070
  • name:Call of the Hunter
  • school:physical
  • tooltip:
  • description:{$@spelldesc191048=When you Marked Shot, |cFFFFCC99Thas'dorah|r has a chance to call forth a barrage of wind arrows to strike all Vulnerable targets.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Pepper Breath 3827 0.8% 18.4 21.49sec 83248 0 Periodic 90.3 16975 0 16975 0.0% 5.7%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.41 0.00 91.54 90.30 0.0000 0.2498 1532822.85 1532822.85 0.00 67040.89 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.3 100.00% 16975.33 68 16990 16976.06 16637 16990 1532823 1532823 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Rancid Maw 11611 2.5% 18.4 21.68sec 253226 0 Direct 18.2 193161 420076 255628 27.5%  

Stats details: rancid_maw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.35 18.18 0.00 0.00 0.0000 0.0000 4647927.32 4647927.32 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.18 72.47% 193161.37 193161 193161 193161.37 193161 193161 2545291 2545291 0.00
crit 5.01 27.53% 420075.53 386323 579484 417799.33 0 579484 2102637 2102637 0.00
 
 

Action details: rancid_maw

Static Values
  • id:215405
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215405
  • name:Rancid Maw
  • school:nature
  • tooltip:
  • description:{$@spelldesc215404=Your ranged attacks and spells have a chance to launch a ball of venom that deals up to {$215405s1=112984 to 124877} Nature damage, based on your distance from the target (maximum damage at 20 yards).}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:180015.50
  • base_dd_max:198964.50
 
Sidewinders 46907 10.1% 41.4 9.71sec 448641 364672 Direct 141.1 104046 217212 131650 24.4%  

Stats details: sidewinders

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.42 141.14 0.00 0.00 1.2303 0.0000 18581129.66 18581129.66 0.00 364671.95 364671.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.71 75.61% 104045.89 102905 112051 104046.17 102997 105367 11102719 11102719 0.00
crit 34.43 24.39% 217211.98 205810 336154 217231.93 205810 251974 7478411 7478411 0.00
 
 

Action details: sidewinders

Static Values
  • id:214579
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
Spelldata
  • id:214579
  • name:Sidewinders
  • school:nature
  • tooltip:
  • description:Launches Sidewinders that travel toward the target, weaving back and forth and dealing {$214581s1=0} Nature damage to each target they hit. Cannot hit the same target twice. Applies Vulnerable to all targets hit. |cFFFFFFFFGenerates {$s2=50} Focus.|r{$?s214579=false}[][ |cFFFFD200Also replaces Multi-Shot.|r]
 
Windburst 21227 4.6% 15.6 24.83sec 544256 394433 Direct 16.6 397392 827422 512470 26.8%  

Stats details: windburst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.62 16.59 0.00 0.00 1.3799 0.0000 8500820.72 12497011.68 31.98 394433.03 394433.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.15 73.24% 397392.28 395429 419675 397371.24 395429 405127 4828445 7098271 31.98
crit 4.44 26.76% 827422.42 790858 1259025 823227.06 0 1259025 3672376 5398740 31.80
 
 

Action details: windburst

Static Values
  • id:204147
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204147
  • name:Windburst
  • school:physical
  • tooltip:
  • description:Focuses the power of Wind through |cFFFFCC99Thas'dorah|r, dealing $sw1 Physical damage to your target, and leaving behind a trail of wind for {$204475d=5 seconds} that increases the movement speed of allies by {$204477s1=50}%.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.00
 
Simple Action Stats Execute Interval
Sarkul
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sarkul
  • harmful:false
  • if_expr:
 
Blood Fury 3.8 120.55sec

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sarkul
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Trueshot 2.8 197.31sec

Stats details: trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: trueshot

Static Values
  • id:193526
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:160.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
Spelldata
  • id:193526
  • name:Trueshot
  • school:physical
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Fury 3.8 0.0 120.5sec 120.6sec 13.90% 13.90% 0.0(0.0) 3.6

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:attack_power
  • amount:2243.00

Stack Uptimes

  • blood_fury_1:13.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 22.36% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bullseye 7.2 305.9 44.4sec 1.1sec 30.24% 30.24% 186.4(186.4) 6.2

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_bullseye
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01

Stack Uptimes

  • bullseye_1:0.17%
  • bullseye_2:0.18%
  • bullseye_3:0.16%
  • bullseye_4:0.15%
  • bullseye_5:4.05%
  • bullseye_6:0.13%
  • bullseye_7:0.13%
  • bullseye_8:0.12%
  • bullseye_9:0.12%
  • bullseye_10:2.20%
  • bullseye_11:0.12%
  • bullseye_12:0.11%
  • bullseye_13:0.10%
  • bullseye_14:0.10%
  • bullseye_15:0.71%
  • bullseye_16:0.09%
  • bullseye_17:0.09%
  • bullseye_18:0.09%
  • bullseye_19:0.09%
  • bullseye_20:0.80%
  • bullseye_21:0.10%
  • bullseye_22:0.10%
  • bullseye_23:0.11%
  • bullseye_24:0.11%
  • bullseye_25:0.41%
  • bullseye_26:0.11%
  • bullseye_27:0.11%
  • bullseye_28:0.10%
  • bullseye_29:0.10%
  • bullseye_30:19.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204090
  • name:Bullseye
  • tooltip:Critical strike chance increased by {$s1=1}%.
  • description:{$@spelldesc204089=When your abilities damage a target below {$s1=20}% health, you gain {$204090s1=1}% increased critical strike chance for {$204090d=6 seconds}, stacking up to {$204090u=30} times.}
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 11.3 0.6 33.3sec 31.4sec 9.46% 11.10% 0.6(0.8) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lock_and_load_1:4.92%
  • lock_and_load_2:4.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:$@spelldesc198811
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Marking Targets 34.7 10.5 11.6sec 8.9sec 36.54% 49.95% 10.5(10.5) 0.1

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_marking_targets
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marking_targets_1:36.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:223138
  • name:Marking Targets
  • tooltip:Next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark.
  • description:Your next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark. Hunter's Mark activates Marked Shot.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 154.1sec 0.0sec 14.69% 14.69% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:14.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.53% 14.53% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Rapid Killing 2.8 0.0 186.9sec 197.0sec 10.25% 10.55% 0.0(0.0) 2.7

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_rapid_killing
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • rapid_killing_1:10.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191342
  • name:Rapid Killing
  • tooltip:Critical damage increased by {$s1=50}%.
  • description:{$@spelldesc191339=Trueshot also increases your critical strike damage by {$191342s1=50}% for its duration.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Trueshot 2.8 0.0 186.9sec 197.0sec 10.25% 16.27% 0.0(0.0) 2.7

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_trueshot
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • trueshot_1:10.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193526
  • name:Trueshot
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Sarkul
aimed_shot Focus 99.8 3838.1 38.5 38.5 11993.7
barrage Focus 19.4 1165.7 60.0 60.0 30530.3
marked_shot Focus 36.1 1083.0 30.0 30.0 54637.8
windburst Focus 16.6 332.4 20.0 21.3 25575.0
Resource Gains Type Count Total Average Overflow
sidewinders Focus 41.42 1924.94 (30.30%) 46.48 145.90 7.05%
focus_regen Focus 1421.95 4427.20 (69.70%) 3.11 433.38 8.92%
Resource RPS-Gain RPS-Loss
Focus 15.86 16.02
Combat End Resource Mean Min Max
Focus 83.59 3.89 150.00

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 7.5%

Procs

Count Interval
starved: barrage 103.5 5.2sec
lock_and_load 12.0 31.4sec
no_vuln_aimed_shot 6.2 42.3sec
no_vuln_marked_shot 5.3 56.6sec
marking_targets 45.2 8.9sec
wasted_marking_targets 10.5 35.0sec

Statistics & Data Analysis

Fight Length
Sample Data Sarkul Fight Length
Count 9999
Mean 400.62
Minimum 307.54
Maximum 499.01
Spread ( max - min ) 191.47
Range [ ( max - min ) / 2 * 100% ] 23.90%
DPS
Sample Data Sarkul Damage Per Second
Count 9999
Mean 461953.57
Minimum 375265.79
Maximum 573393.80
Spread ( max - min ) 198128.01
Range [ ( max - min ) / 2 * 100% ] 21.44%
Standard Deviation 31910.7418
5th Percentile 414447.74
95th Percentile 517611.76
( 95th Percentile - 5th Percentile ) 103164.03
Mean Distribution
Standard Deviation 319.1234
95.00% Confidence Intervall ( 461328.10 - 462579.04 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 183
0.1% Error 18330
0.1 Scale Factor Error with Delta=300 8692755
0.05 Scale Factor Error with Delta=300 34771022
0.01 Scale Factor Error with Delta=300 869275556
Priority Target DPS
Sample Data Sarkul Priority Target Damage Per Second
Count 9999
Mean 276686.39
Minimum 239305.22
Maximum 318996.79
Spread ( max - min ) 79691.57
Range [ ( max - min ) / 2 * 100% ] 14.40%
Standard Deviation 10346.8599
5th Percentile 260048.58
95th Percentile 294189.51
( 95th Percentile - 5th Percentile ) 34140.93
Mean Distribution
Standard Deviation 103.4738
95.00% Confidence Intervall ( 276483.59 - 276889.20 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 53
0.1% Error 5372
0.1 Scale Factor Error with Delta=300 913904
0.05 Scale Factor Error with Delta=300 3655617
0.01 Scale Factor Error with Delta=300 91390447
DPS(e)
Sample Data Sarkul Damage Per Second (Effective)
Count 9999
Mean 461953.57
Minimum 375265.79
Maximum 573393.80
Spread ( max - min ) 198128.01
Range [ ( max - min ) / 2 * 100% ] 21.44%
Damage
Sample Data Sarkul Damage
Count 9999
Mean 183820910.62
Minimum 143939810.74
Maximum 223175985.79
Spread ( max - min ) 79236175.05
Range [ ( max - min ) / 2 * 100% ] 21.55%
DTPS
Sample Data Sarkul Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Sarkul Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Sarkul Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Sarkul Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Sarkul Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Sarkul Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data SarkulTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Sarkul Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
6 0.00 windburst
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
0.00 arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
8 3.77 blood_fury
0.00 berserking
0.00 auto_shot
0.00 variable,name=vulnerable_time,value=debuff.vulnerability.remains
9 0.00 call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
A 0.00 call_action_list,name=cooldowns
0.00 a_murder_of_crows,if=debuff.hunters_mark.down
B 0.00 call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
C 12.02 barrage,if=debuff.hunters_mark.down
0.00 black_arrow,if=debuff.hunters_mark.down
0.00 a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
D 6.41 barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
0.00 black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
0.00 piercing_shot,if=!talent.patient_sniper.enabled&focus>50
E 17.65 windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
0.00 windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
F 0.00 call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
G 11.60 sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
0.00 sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
0.00 marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
0.00 arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 explosive_shot
H 20.95 marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
I 28.67 aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
J 67.42 aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
K 10.41 marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
L 0.99 marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
M 25.96 sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
0.00 piercing_shot,if=talent.patient_sniper.enabled&focus>80
0.00 arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
0.00 multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
N 7.58 aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
0.00 multishot,if=spell_targets.barrage>2
actions.cooldowns
# count action,conditions
O 1.00 potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
P 1.77 /trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
actions.open
# count action,conditions
0.00 a_murder_of_crows
Q 1.00 trueshot
R 1.21 sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
S 2.99 marked_shot
T 1.16 aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
0.00 black_arrow
U 1.00 barrage
V 7.69 aimed_shot,if=execute_time<debuff.vulnerability.remains
W 1.85 sidewinders
0.00 aimed_shot
0.00 arcane_shot
actions.targetdie
# count action,conditions
X 0.76 marked_shot
0.00 windburst
Y 1.37 aimed_shot,if=execute_time<debuff.vulnerability.remains
Z 0.80 sidewinders
a 0.05 aimed_shot
0.00 arcane_shot

Sample Sequence

045678QUVVRSVVTVVRSVWSVJJMDHEJJMHJJMHJJMHJJCEMIHJJMHJJCEOJMIIHJCEGJJMHJJMIDKMEHJJ8NMHCNEJJJMHJJCNGEJPJGIIIKGDHJGHJJEJJJGCJMIIKENNNCGJJMHJJEJJJCGHJJ8NGJEJJMDKJNGJEJJCGHJJJNGJJECGHJJMHJJCEGIIKJMIIKJCPEGIIIIKGIKJGIIIKMD8EKJMIIKJJJCEGIXYY

Sample Sequence Table

time name target resources buffs
Pre flask Sarkul 150.0/150: 100% focus
Pre potion Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
Pre augmentation Sarkul 150.0/150: 100% focus potion_of_deadly_grace
0:00.000 windburst Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 blood_fury Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 trueshot Fluffy_Pillow 130.0/150: 87% focus blood_fury, potion_of_deadly_grace
0:00.000 barrage Fluffy_Pillow 130.0/150: 87% focus blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:02.201 aimed_shot Fluffy_Pillow 111.1/150: 74% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.178 aimed_shot Fluffy_Pillow 81.2/150: 54% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:04.155 sidewinders Fluffy_Pillow 51.2/150: 34% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:04.910 marked_shot Fluffy_Pillow 116.8/150: 78% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:05.663 aimed_shot Fluffy_Pillow 102.2/150: 68% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:06.640 aimed_shot Fluffy_Pillow 72.3/150: 48% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:07.615 aimed_shot Fluffy_Pillow 92.4/150: 62% focus bloodlust, blood_fury, lock_and_load, rapid_killing, trueshot, potion_of_deadly_grace
0:08.370 aimed_shot Fluffy_Pillow 107.9/150: 72% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:09.346 aimed_shot Fluffy_Pillow 78.0/150: 52% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:10.321 sidewinders Fluffy_Pillow 48.0/150: 32% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:11.076 marked_shot Fluffy_Pillow 113.5/150: 76% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:11.832 aimed_shot Fluffy_Pillow 99.1/150: 66% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:12.585 sidewinders Fluffy_Pillow 114.6/150: 76% focus bloodlust, blood_fury, raid_movement, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:13.340 marked_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:14.093 aimed_shot Fluffy_Pillow 135.5/150: 90% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:15.070 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bloodlust, potion_of_deadly_grace
0:16.437 aimed_shot Fluffy_Pillow 70.1/150: 47% focus bloodlust, potion_of_deadly_grace
0:17.802 Waiting 1.900 sec 40.2/150: 27% focus bloodlust, potion_of_deadly_grace
0:19.702 sidewinders Fluffy_Pillow 68.1/150: 45% focus bloodlust, marking_targets, potion_of_deadly_grace
0:20.727 barrage Fluffy_Pillow 133.2/150: 89% focus bloodlust, raid_movement, potion_of_deadly_grace
0:22.990 marked_shot Fluffy_Pillow 106.4/150: 71% focus bloodlust, raid_movement, potion_of_deadly_grace
0:24.017 windburst Fluffy_Pillow 91.5/150: 61% focus bloodlust, marking_targets, potion_of_deadly_grace
0:25.041 aimed_shot Fluffy_Pillow 86.5/150: 58% focus bloodlust, marking_targets, potion_of_deadly_grace
0:26.406 aimed_shot Fluffy_Pillow 56.6/150: 38% focus bloodlust, marking_targets, potion_of_deadly_grace
0:27.770 sidewinders Fluffy_Pillow 26.6/150: 18% focus bloodlust, marking_targets, potion_of_deadly_grace
0:28.794 marked_shot Fluffy_Pillow 91.6/150: 61% focus bloodlust, raid_movement
0:29.820 aimed_shot Fluffy_Pillow 76.7/150: 51% focus bloodlust
0:31.183 Waiting 0.300 sec 46.7/150: 31% focus bloodlust
0:31.483 aimed_shot Fluffy_Pillow 51.1/150: 34% focus bloodlust, marking_targets
0:32.849 sidewinders Fluffy_Pillow 21.2/150: 14% focus bloodlust, marking_targets
0:33.874 marked_shot Fluffy_Pillow 86.2/150: 57% focus bloodlust, marking_targets
0:34.899 aimed_shot Fluffy_Pillow 71.3/150: 48% focus bloodlust, marking_targets
0:36.263 Waiting 0.600 sec 41.3/150: 28% focus bloodlust, marking_targets
0:36.863 aimed_shot Fluffy_Pillow 50.1/150: 33% focus bloodlust, marking_targets
0:38.228 sidewinders Fluffy_Pillow 20.2/150: 13% focus bloodlust, marking_targets
0:39.361 marked_shot Fluffy_Pillow 86.8/150: 58% focus bloodlust, bullseye(5)
0:40.386 aimed_shot Fluffy_Pillow 71.9/150: 48% focus bloodlust, bullseye(20), marking_targets
0:41.753 Waiting 1.200 sec 37.3/150: 25% focus bullseye(20), marking_targets
0:42.953 aimed_shot Fluffy_Pillow 50.9/150: 34% focus bullseye(20), marking_targets
0:44.286 barrage Fluffy_Pillow 65.9/150: 44% focus raid_movement, bullseye(20), marking_targets
0:47.183 windburst Fluffy_Pillow 38.6/150: 26% focus marking_targets
0:48.516 sidewinders Fluffy_Pillow 33.7/150: 22% focus marking_targets
0:49.847 aimed_shot Fluffy_Pillow 98.7/150: 66% focus
0:51.177 marked_shot Fluffy_Pillow 113.8/150: 76% focus raid_movement
0:52.507 Waiting 1.100 sec 98.8/150: 66% focus raid_movement
0:53.607 aimed_shot Fluffy_Pillow 111.2/150: 74% focus marking_targets
0:55.381 aimed_shot Fluffy_Pillow 81.3/150: 54% focus marking_targets
0:57.155 Waiting 1.400 sec 51.3/150: 34% focus marking_targets
0:58.555 sidewinders Fluffy_Pillow 67.1/150: 45% focus marking_targets
1:00.113 marked_shot Fluffy_Pillow 134.7/150: 90% focus raid_movement
1:01.443 aimed_shot Fluffy_Pillow 119.7/150: 80% focus
1:03.219 aimed_shot Fluffy_Pillow 89.8/150: 60% focus
1:04.992 Waiting 0.100 sec 59.8/150: 40% focus
1:05.092 barrage Fluffy_Pillow 61.0/150: 41% focus
1:08.020 Waiting 0.300 sec 34.0/150: 23% focus bullseye(30)
1:08.320 windburst Fluffy_Pillow 37.4/150: 25% focus bullseye(30)
1:09.843 potion Fluffy_Pillow 34.6/150: 23% focus bullseye(30)
1:09.843 Waiting 1.400 sec 34.6/150: 23% focus bullseye(30), potion_of_deadly_grace
1:11.243 aimed_shot Fluffy_Pillow 50.5/150: 34% focus bullseye(30), potion_of_deadly_grace
1:13.018 Waiting 3.200 sec 20.5/150: 14% focus bullseye(30), potion_of_deadly_grace
1:16.218 sidewinders Fluffy_Pillow 56.7/150: 38% focus raid_movement, marking_targets, potion_of_deadly_grace
1:17.549 aimed_shot Fluffy_Pillow 121.7/150: 81% focus potion_of_deadly_grace
1:19.322 aimed_shot Fluffy_Pillow 91.7/150: 61% focus potion_of_deadly_grace
1:20.654 marked_shot Fluffy_Pillow 106.8/150: 71% focus raid_movement, potion_of_deadly_grace
1:21.986 Waiting 1.600 sec 91.8/150: 61% focus raid_movement, potion_of_deadly_grace
1:23.586 aimed_shot Fluffy_Pillow 109.9/150: 73% focus potion_of_deadly_grace
1:25.359 barrage Fluffy_Pillow 79.9/150: 53% focus potion_of_deadly_grace
1:28.289 Waiting 1.300 sec 53.0/150: 35% focus potion_of_deadly_grace
1:29.589 windburst Fluffy_Pillow 67.7/150: 45% focus potion_of_deadly_grace
1:31.168 sidewinders Fluffy_Pillow 65.5/150: 44% focus potion_of_deadly_grace
1:32.500 Waiting 0.700 sec 130.6/150: 87% focus raid_movement, potion_of_deadly_grace
1:33.200 aimed_shot Fluffy_Pillow 138.5/150: 92% focus potion_of_deadly_grace
1:34.974 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets, potion_of_deadly_grace
1:36.749 sidewinders Fluffy_Pillow 70.1/150: 47% focus marking_targets, potion_of_deadly_grace
1:38.082 marked_shot Fluffy_Pillow 135.2/150: 90% focus bullseye(5), potion_of_deadly_grace
1:39.414 aimed_shot Fluffy_Pillow 120.2/150: 80% focus bullseye(10), potion_of_deadly_grace
1:41.190 aimed_shot Fluffy_Pillow 90.3/150: 60% focus bullseye(10)
1:42.965 sidewinders Fluffy_Pillow 60.3/150: 40% focus bullseye(10), marking_targets
1:44.297 aimed_shot Fluffy_Pillow 125.4/150: 84% focus
1:46.072 barrage Fluffy_Pillow 95.4/150: 64% focus marking_targets
1:48.941 marked_shot Fluffy_Pillow 67.8/150: 45% focus raid_movement, marking_targets
1:50.273 Waiting 1.900 sec 52.9/150: 35% focus raid_movement, marking_targets
1:52.173 sidewinders Fluffy_Pillow 74.3/150: 50% focus raid_movement, marking_targets
1:53.744 windburst Fluffy_Pillow 142.1/150: 95% focus
1:55.076 marked_shot Fluffy_Pillow 130.1/150: 87% focus
1:56.408 aimed_shot Fluffy_Pillow 115.1/150: 77% focus
1:58.181 aimed_shot Fluffy_Pillow 85.1/150: 57% focus
1:59.955 blood_fury Fluffy_Pillow 55.2/150: 37% focus
2:00.000 Waiting 2.200 sec 55.7/150: 37% focus blood_fury
2:02.200 aimed_shot Fluffy_Pillow 80.5/150: 54% focus blood_fury
2:03.974 sidewinders Fluffy_Pillow 50.6/150: 34% focus blood_fury, marking_targets
2:05.306 marked_shot Fluffy_Pillow 115.6/150: 77% focus blood_fury
2:06.639 barrage Fluffy_Pillow 100.7/150: 67% focus blood_fury
2:09.542 Waiting 1.800 sec 73.5/150: 49% focus blood_fury, bullseye(30)
2:11.342 aimed_shot Fluffy_Pillow 93.8/150: 63% focus blood_fury, bullseye(30)
2:13.116 Waiting 1.800 sec 63.9/150: 43% focus blood_fury, bullseye(30)
2:14.916 windburst Fluffy_Pillow 84.2/150: 56% focus blood_fury, bullseye(30)
2:16.404 aimed_shot Fluffy_Pillow 81.0/150: 54% focus
2:18.180 aimed_shot Fluffy_Pillow 101.1/150: 67% focus lock_and_load
2:19.512 aimed_shot Fluffy_Pillow 116.1/150: 77% focus
2:20.842 sidewinders Fluffy_Pillow 131.1/150: 87% focus marking_targets
2:22.172 marked_shot Fluffy_Pillow 150.0/150: 100% focus
2:23.504 aimed_shot Fluffy_Pillow 135.0/150: 90% focus
2:25.279 aimed_shot Fluffy_Pillow 100.1/150: 67% focus
2:27.052 barrage Fluffy_Pillow 70.1/150: 47% focus
2:29.873 Waiting 3.400 sec 42.0/150: 28% focus
2:33.273 aimed_shot Fluffy_Pillow 80.4/150: 54% focus
2:35.047 sidewinders Fluffy_Pillow 50.4/150: 34% focus
2:36.378 Waiting 0.800 sec 115.4/150: 77% focus raid_movement, marking_targets
2:37.178 windburst Fluffy_Pillow 124.5/150: 83% focus marking_targets
2:38.510 aimed_shot Fluffy_Pillow 119.5/150: 80% focus marking_targets
2:40.284 trueshot Fluffy_Pillow 89.6/150: 60% focus marking_targets
2:40.284 aimed_shot Fluffy_Pillow 89.6/150: 60% focus marking_targets, rapid_killing, trueshot
2:41.552 sidewinders Fluffy_Pillow 59.6/150: 40% focus marking_targets, rapid_killing, trueshot
2:42.504 aimed_shot Fluffy_Pillow 124.7/150: 83% focus rapid_killing, trueshot
2:43.772 aimed_shot Fluffy_Pillow 94.7/150: 63% focus rapid_killing, trueshot
2:45.041 aimed_shot Fluffy_Pillow 64.8/150: 43% focus rapid_killing, trueshot
2:46.311 marked_shot Fluffy_Pillow 34.9/150: 23% focus rapid_killing, trueshot
2:47.265 sidewinders Fluffy_Pillow 20.0/150: 13% focus rapid_killing, trueshot
2:48.217 barrage Fluffy_Pillow 85.0/150: 57% focus rapid_killing, trueshot
2:50.433 marked_shot Fluffy_Pillow 60.1/150: 40% focus raid_movement, rapid_killing, trueshot
2:51.387 Waiting 1.300 sec 45.2/150: 30% focus raid_movement, marking_targets, rapid_killing, trueshot
2:52.687 aimed_shot Fluffy_Pillow 65.7/150: 44% focus marking_targets, rapid_killing, trueshot
2:53.958 sidewinders Fluffy_Pillow 35.8/150: 24% focus marking_targets, rapid_killing, trueshot
2:54.912 marked_shot Fluffy_Pillow 100.9/150: 67% focus rapid_killing, trueshot
2:55.863 aimed_shot Fluffy_Pillow 83.3/150: 56% focus
2:57.639 aimed_shot Fluffy_Pillow 53.4/150: 36% focus
2:59.412 windburst Fluffy_Pillow 73.4/150: 49% focus lock_and_load
3:00.744 aimed_shot Fluffy_Pillow 68.5/150: 46% focus lock_and_load
3:02.074 aimed_shot Fluffy_Pillow 83.5/150: 56% focus
3:03.850 aimed_shot Fluffy_Pillow 53.6/150: 36% focus
3:05.627 Waiting 2.100 sec 23.6/150: 16% focus
3:07.727 sidewinders Fluffy_Pillow 47.4/150: 32% focus
3:09.059 barrage Fluffy_Pillow 112.4/150: 75% focus raid_movement, bullseye(5)
3:11.887 aimed_shot Fluffy_Pillow 84.4/150: 56% focus bullseye(30)
3:13.660 sidewinders Fluffy_Pillow 54.4/150: 36% focus bullseye(30), marking_targets
3:14.993 aimed_shot Fluffy_Pillow 119.5/150: 80% focus bullseye(30)
3:16.768 aimed_shot Fluffy_Pillow 89.5/150: 60% focus
3:18.543 Waiting 0.200 sec 109.6/150: 73% focus lock_and_load
3:18.743 marked_shot Fluffy_Pillow 111.8/150: 75% focus lock_and_load
3:20.074 Waiting 3.500 sec 96.9/150: 65% focus raid_movement, lock_and_load
3:23.574 windburst Fluffy_Pillow 136.4/150: 91% focus lock_and_load
3:24.909 Waiting 0.300 sec 150.0/150: 100% focus raid_movement, lock_and_load
3:25.209 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load
3:26.540 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
3:28.315 aimed_shot Fluffy_Pillow 100.1/150: 67% focus
3:30.089 barrage Fluffy_Pillow 70.1/150: 47% focus
3:33.068 sidewinders Fluffy_Pillow 43.8/150: 29% focus
3:34.400 aimed_shot Fluffy_Pillow 108.8/150: 73% focus marking_targets
3:36.173 aimed_shot Fluffy_Pillow 78.8/150: 53% focus marking_targets
3:37.948 sidewinders Fluffy_Pillow 48.9/150: 33% focus marking_targets
3:39.280 marked_shot Fluffy_Pillow 113.9/150: 76% focus bullseye(5)
3:40.612 Waiting 0.600 sec 99.0/150: 66% focus raid_movement, bullseye(10)
3:41.212 aimed_shot Fluffy_Pillow 105.8/150: 71% focus bullseye(10)
3:42.986 aimed_shot Fluffy_Pillow 75.8/150: 51% focus bullseye(10)
3:44.761 windburst Fluffy_Pillow 95.8/150: 64% focus bullseye(10), lock_and_load, marking_targets
3:46.094 aimed_shot Fluffy_Pillow 90.9/150: 61% focus lock_and_load, marking_targets
3:47.424 aimed_shot Fluffy_Pillow 105.9/150: 71% focus marking_targets
3:49.200 aimed_shot Fluffy_Pillow 76.0/150: 51% focus marking_targets
3:50.531 barrage Fluffy_Pillow 91.0/150: 61% focus raid_movement, marking_targets
3:53.490 sidewinders Fluffy_Pillow 64.5/150: 43% focus raid_movement, marking_targets
3:54.822 marked_shot Fluffy_Pillow 129.5/150: 86% focus
3:56.153 Waiting 1.000 sec 114.5/150: 76% focus raid_movement
3:57.153 aimed_shot Fluffy_Pillow 125.8/150: 84% focus
3:58.927 aimed_shot Fluffy_Pillow 95.9/150: 64% focus
4:00.702 blood_fury Fluffy_Pillow 65.9/150: 44% focus
4:00.702 Waiting 1.300 sec 65.9/150: 44% focus blood_fury
4:02.002 aimed_shot Fluffy_Pillow 80.6/150: 54% focus blood_fury
4:03.776 Waiting 0.100 sec 50.7/150: 34% focus blood_fury
4:03.876 sidewinders Fluffy_Pillow 51.8/150: 35% focus blood_fury
4:05.207 aimed_shot Fluffy_Pillow 116.8/150: 78% focus blood_fury
4:06.981 windburst Fluffy_Pillow 86.9/150: 58% focus blood_fury
4:08.314 aimed_shot Fluffy_Pillow 81.9/150: 55% focus blood_fury
4:10.089 aimed_shot Fluffy_Pillow 52.0/150: 35% focus blood_fury, marking_targets
4:11.865 sidewinders Fluffy_Pillow 22.0/150: 15% focus blood_fury, marking_targets
4:13.197 barrage Fluffy_Pillow 87.1/150: 58% focus blood_fury
4:16.136 Waiting 0.800 sec 60.3/150: 40% focus
4:16.936 marked_shot Fluffy_Pillow 69.3/150: 46% focus
4:18.266 aimed_shot Fluffy_Pillow 54.3/150: 36% focus
4:20.005 Waiting 3.600 sec 74.0/150: 49% focus raid_movement
4:23.605 aimed_shot Fluffy_Pillow 114.7/150: 76% focus
4:25.382 sidewinders Fluffy_Pillow 84.7/150: 56% focus
4:26.714 aimed_shot Fluffy_Pillow 149.8/150: 100% focus
4:28.046 Waiting 1.100 sec 150.0/150: 100% focus raid_movement, marking_targets
4:29.146 windburst Fluffy_Pillow 150.0/150: 100% focus marking_targets
4:30.478 aimed_shot Fluffy_Pillow 130.1/150: 87% focus marking_targets
4:32.253 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets
4:34.029 barrage Fluffy_Pillow 70.1/150: 47% focus marking_targets
4:36.871 sidewinders Fluffy_Pillow 42.2/150: 28% focus bullseye(20), marking_targets
4:38.203 marked_shot Fluffy_Pillow 107.3/150: 72% focus bullseye(25), lock_and_load(2)
4:39.534 aimed_shot Fluffy_Pillow 92.3/150: 62% focus bullseye(30), lock_and_load(2)
4:40.866 aimed_shot Fluffy_Pillow 107.4/150: 72% focus bullseye(30), lock_and_load
4:42.197 aimed_shot Fluffy_Pillow 122.4/150: 82% focus bullseye(30)
4:43.971 Waiting 1.200 sec 92.4/150: 62% focus bullseye(30)
4:45.171 aimed_shot Fluffy_Pillow 106.0/150: 71% focus lock_and_load(2)
4:46.500 sidewinders Fluffy_Pillow 121.0/150: 81% focus lock_and_load
4:47.832 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets
4:49.163 aimed_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets
4:50.494 Waiting 3.100 sec 150.0/150: 100% focus raid_movement, marking_targets
4:53.594 windburst Fluffy_Pillow 150.0/150: 100% focus marking_targets
4:54.926 barrage Fluffy_Pillow 130.1/150: 87% focus marking_targets
4:57.834 sidewinders Fluffy_Pillow 102.9/150: 69% focus marking_targets
4:59.165 marked_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets
5:00.497 Waiting 0.700 sec 135.0/150: 90% focus raid_movement, marking_targets
5:01.197 aimed_shot Fluffy_Pillow 143.0/150: 95% focus marking_targets
5:02.972 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets
5:04.746 sidewinders Fluffy_Pillow 70.1/150: 47% focus marking_targets
5:06.076 marked_shot Fluffy_Pillow 135.1/150: 90% focus
5:07.407 aimed_shot Fluffy_Pillow 120.2/150: 80% focus bullseye(5)
5:09.181 aimed_shot Fluffy_Pillow 90.2/150: 60% focus bullseye(5)
5:10.957 Waiting 3.800 sec 60.3/150: 40% focus bullseye(5)
5:14.757 barrage Fluffy_Pillow 103.2/150: 69% focus marking_targets
5:17.675 windburst Fluffy_Pillow 76.2/150: 51% focus marking_targets
5:19.005 sidewinders Fluffy_Pillow 71.2/150: 47% focus marking_targets
5:20.336 aimed_shot Fluffy_Pillow 136.2/150: 91% focus bullseye
5:22.109 aimed_shot Fluffy_Pillow 100.0/150: 67% focus bullseye(2)
5:23.883 Waiting 0.200 sec 70.1/150: 47% focus bullseye(4)
5:24.083 marked_shot Fluffy_Pillow 72.3/150: 48% focus bullseye(4)
5:25.416 aimed_shot Fluffy_Pillow 57.4/150: 38% focus bullseye(6)
5:27.190 sidewinders Fluffy_Pillow 27.4/150: 18% focus bullseye(7), marking_targets
5:28.523 aimed_shot Fluffy_Pillow 92.5/150: 62% focus bullseye(9)
5:30.298 aimed_shot Fluffy_Pillow 62.5/150: 42% focus bullseye(10)
5:32.004 Waiting 0.200 sec 81.8/150: 55% focus raid_movement, bullseye(12), lock_and_load(2)
5:32.204 marked_shot Fluffy_Pillow 84.1/150: 56% focus raid_movement, bullseye(12), lock_and_load(2)
5:33.535 aimed_shot Fluffy_Pillow 69.1/150: 46% focus bullseye(19), lock_and_load(2)
5:34.867 barrage Fluffy_Pillow 84.2/150: 56% focus bullseye(21), lock_and_load
5:37.928 trueshot Fluffy_Pillow 58.7/150: 39% focus bullseye(30), lock_and_load
5:37.928 Waiting 0.900 sec 58.7/150: 39% focus bullseye(30), lock_and_load, rapid_killing, trueshot
5:38.828 windburst Fluffy_Pillow 73.0/150: 49% focus bullseye(30), lock_and_load, rapid_killing, trueshot
5:39.955 sidewinders Fluffy_Pillow 70.8/150: 47% focus bullseye(30), lock_and_load, rapid_killing, trueshot
5:40.907 aimed_shot Fluffy_Pillow 135.9/150: 91% focus bullseye(30), lock_and_load, rapid_killing, trueshot
5:41.860 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(30), rapid_killing, trueshot
5:43.128 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:44.396 aimed_shot Fluffy_Pillow 70.1/150: 47% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:45.665 marked_shot Fluffy_Pillow 40.2/150: 27% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:46.616 sidewinders Fluffy_Pillow 25.2/150: 17% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:47.570 aimed_shot Fluffy_Pillow 90.3/150: 60% focus bullseye(30), rapid_killing, trueshot
5:48.524 marked_shot Fluffy_Pillow 105.4/150: 70% focus raid_movement, bullseye(30), rapid_killing, trueshot
5:49.475 aimed_shot Fluffy_Pillow 90.4/150: 60% focus bullseye(30), rapid_killing, trueshot
5:50.743 sidewinders Fluffy_Pillow 60.5/150: 40% focus bullseye(30), rapid_killing, trueshot
5:51.696 aimed_shot Fluffy_Pillow 125.6/150: 84% focus bullseye(30), rapid_killing, trueshot
5:52.964 aimed_shot Fluffy_Pillow 95.5/150: 64% focus bullseye(30)
5:54.737 aimed_shot Fluffy_Pillow 65.5/150: 44% focus bullseye(30)
5:56.511 marked_shot Fluffy_Pillow 35.5/150: 24% focus bullseye(30)
5:57.844 Waiting 0.800 sec 20.6/150: 14% focus bullseye(30)
5:58.644 sidewinders Fluffy_Pillow 29.6/150: 20% focus bullseye(30), marking_targets
5:59.977 barrage Fluffy_Pillow 94.7/150: 63% focus bullseye(30)
6:02.907 blood_fury Fluffy_Pillow 67.8/150: 45% focus bullseye(30)
6:02.907 windburst Fluffy_Pillow 67.8/150: 45% focus blood_fury, bullseye(30)
6:04.241 marked_shot Fluffy_Pillow 82.9/150: 55% focus blood_fury, raid_movement, bullseye(30)
6:05.571 aimed_shot Fluffy_Pillow 67.9/150: 45% focus blood_fury, bullseye(30)
6:07.344 sidewinders Fluffy_Pillow 37.9/150: 25% focus blood_fury, bullseye(30), marking_targets
6:08.676 aimed_shot Fluffy_Pillow 103.0/150: 69% focus blood_fury, bullseye(30)
6:10.451 aimed_shot Fluffy_Pillow 73.0/150: 49% focus blood_fury, bullseye(30)
6:12.226 Waiting 0.200 sec 43.1/150: 29% focus blood_fury, bullseye(30)
6:12.426 marked_shot Fluffy_Pillow 45.3/150: 30% focus blood_fury, bullseye(30)
6:13.757 aimed_shot Fluffy_Pillow 30.4/150: 20% focus blood_fury, bullseye(30), lock_and_load(2)
6:15.089 aimed_shot Fluffy_Pillow 45.4/150: 30% focus blood_fury, bullseye(30), lock_and_load
6:16.421 aimed_shot Fluffy_Pillow 60.5/150: 40% focus blood_fury, bullseye(30)
6:18.196 Waiting 2.700 sec 30.5/150: 20% focus bullseye(30)
6:20.896 barrage Fluffy_Pillow 61.0/150: 41% focus raid_movement, bullseye(30)
6:23.827 windburst Fluffy_Pillow 34.1/150: 23% focus bullseye(30)
6:25.331 sidewinders Fluffy_Pillow 31.1/150: 21% focus bullseye(30), marking_targets
6:26.664 aimed_shot Fluffy_Pillow 96.2/150: 64% focus bullseye(30)
6:28.439 marked_shot Fluffy_Pillow 66.2/150: 44% focus bullseye(30), marking_targets
6:29.771 aimed_shot Fluffy_Pillow 51.3/150: 34% focus bullseye(30), lock_and_load(2), marking_targets
6:31.102 aimed_shot Fluffy_Pillow 66.3/150: 44% focus bullseye(30), lock_and_load, marking_targets

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6234 6234 0
Agility 24895 23530 13383 (8947)
Stamina 34418 34418 21497
Intellect 6003 6003 0
Spirit 2 2 0
Health 2065080 2065080 0
Focus 150 150 0
Crit 20.73% 20.73% 2005
Haste 12.97% 12.97% 4215
Damage / Heal Versatility 1.94% 1.94% 775
Attack Power 24895 23530 0
Mastery 26.61% 26.61% 12100
Armor 2603 2603 2603
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 860.00
Local Head Greyed Dragonscale Coif
ilevel: 870, stats: { 358 Armor, +2344 Sta, +1563 AgiInt, +794 Mastery, +613 Crit }
Local Neck Wolfstride Pendant
ilevel: 850, stats: { +1094 Sta, +1311 Mastery, +525 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Thorny Bramblemail Pauldrons
ilevel: 850, stats: { 310 Armor, +1459 Sta, +973 AgiInt, +658 Mastery, +322 Haste }, gems: { +150 Mastery }
Local Shirt Wraps of the Blood-Soaked Brawler
ilevel: 1
Local Chest Mountainforged Chain Hauberk
ilevel: 850, stats: { 414 Armor, +1945 Sta, +1297 AgiInt, +654 Haste, +654 Mastery }
Local Waist Roar of the Seven Lions
ilevel: 895, stats: { 268 Armor, +2219 Sta, +1479 Agi, +662 Haste, +496 Mastery }
Local Legs Leggings of Biting Links
ilevel: 855, stats: { 368 Armor, +2038 Sta, +1359 AgiInt, +921 Mastery, +409 Vers }
Local Feet Black Venom Sabatons
ilevel: 865, stats: { 298 Armor, +1678 Sta, +1119 AgiInt, +718 Haste, +317 Mastery }
Local Wrists Ley Dragoon's Wristbraces
ilevel: 865, stats: { 190 Armor, +839 AgiInt, +1258 Sta, +505 Mastery, +272 Haste }
Local Hands Ley Dragoon's Gloves
ilevel: 860, stats: { 267 Armor, +1068 AgiInt, +1601 Sta, +595 Mastery, +421 Haste }
Local Finger1 Empowered Ring of the Kirin Tor
ilevel: 850, stats: { +1094 Sta, +1180 Mastery, +655 Crit }, enchant: { +150 Mastery }
Local Finger2 Nightborne Signet Ring
ilevel: 855, stats: { +1147 Sta, +1230 Mastery, +641 Haste }, enchant: { +200 Mastery }
Local Trinket1 Naraxas' Spiked Tongue
ilevel: 860, stats: { +968 Mastery }
Local Trinket2 Mana Crystal Shard
ilevel: 840, stats: { +1123 Agi, +898 Mastery }
Local Back Cape of Valarjar Courage
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +366 Mastery, +366 Vers }, enchant: { +150 Agi }
Local Main Hand Thas'dorah, Legacy of the Windrunners
ilevel: 878, weapon: { 9075 - 9077, 3 }, stats: { +1684 Agi, +2526 Sta, +737 Crit, +707 Mastery }, relics: { +43 ilevels, +42 ilevels, +43 ilevels }

Talents

Level
15 Lone Wolf (Marksmanship Hunter) Steady Focus (Marksmanship Hunter) Careful Aim (Marksmanship Hunter)
30 Lock and Load (Marksmanship Hunter) Black Arrow (Marksmanship Hunter) True Aim (Marksmanship Hunter)
45 Posthaste Farstrider Trailblazer
60 Explosive Shot (Marksmanship Hunter) Sentinel (Marksmanship Hunter) Patient Sniper (Marksmanship Hunter)
75 Binding Shot Wyvern Sting Camouflage (Marksmanship Hunter)
90 A Murder of Crows Barrage Volley
100 Sidewinders (Marksmanship Hunter) Piercing Shot (Marksmanship Hunter) Trick Shot (Marksmanship Hunter)

Profile

hunter="Sarkul"
origin="https://us.api.battle.net/wow/character/thrall/Sarkul/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/171/133787819-avatar.jpg"
level=110
race=orc
role=attack
position=ranged_back
professions=engineering=709/leatherworking=800
talents=1133121
artifact=55:0:0:0:0:307:1:308:1:310:1:311:1:312:3:313:3:314:2:315:3:318:3:319:3:320:3:321:1:322:1:1337:1
spec=marksmanship

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/windburst

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
actions+=/blood_fury
actions+=/berserking
actions+=/auto_shot
actions+=/variable,name=vulnerable_time,value=debuff.vulnerability.remains
actions+=/call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
actions+=/call_action_list,name=cooldowns
actions+=/a_murder_of_crows,if=debuff.hunters_mark.down
actions+=/call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
actions+=/barrage,if=debuff.hunters_mark.down
actions+=/black_arrow,if=debuff.hunters_mark.down
actions+=/a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
actions+=/barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
actions+=/black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
actions+=/piercing_shot,if=!talent.patient_sniper.enabled&focus>50
actions+=/windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
actions+=/windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
actions+=/call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
actions+=/sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
actions+=/sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
actions+=/marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
actions+=/arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/explosive_shot
actions+=/marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
actions+=/aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
actions+=/aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
actions+=/marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
actions+=/marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
actions+=/sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
actions+=/piercing_shot,if=talent.patient_sniper.enabled&focus>80
actions+=/arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
actions+=/multishot,if=spell_targets.barrage>2

actions.cooldowns=potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
actions.cooldowns+=//trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16

actions.open=a_murder_of_crows
actions.open+=/trueshot
actions.open+=/sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
actions.open+=/marked_shot
actions.open+=/aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.open+=/black_arrow
actions.open+=/barrage
actions.open+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.open+=/sidewinders
actions.open+=/aimed_shot
actions.open+=/arcane_shot

actions.targetdie=marked_shot
actions.targetdie+=/windburst
actions.targetdie+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.targetdie+=/sidewinders
actions.targetdie+=/aimed_shot
actions.targetdie+=/arcane_shot

actions.trueshotaoe=marked_shot
actions.trueshotaoe+=/piercing_shot
actions.trueshotaoe+=/barrage
actions.trueshotaoe+=/explosive_shot
actions.trueshotaoe+=/aimed_shot,if=active_enemies=2&buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.trueshotaoe+=/multishot

head=greyed_dragonscale_coif,id=139214,bonus_id=1807/1492/3337
neck=wolfstride_pendant,id=133633,bonus_id=1727/1502/3336,enchant=mark_of_the_hidden_satyr
shoulders=thorny_bramblemail_pauldrons,id=139218,bonus_id=1807/1808/1472,gems=150mastery
back=cape_of_valarjar_courage,id=133765,bonus_id=3412/1502/1813,enchant=150agi
chest=mountainforged_chain_hauberk,id=139597
shirt=wraps_of_the_bloodsoaked_brawler,id=98543
wrists=ley_dragoons_wristbraces,id=134296,bonus_id=3414/1527/3336
hands=ley_dragoons_gloves,id=134297,bonus_id=3397/1522/3337
waist=roar_of_the_seven_lions,id=137080,bonus_id=1811
legs=leggings_of_biting_links,id=137518,bonus_id=1727/1507/3337
feet=black_venom_sabatons,id=139219,bonus_id=1805/1487
finger1=empowered_ring_of_the_kirin_tor,id=139599,enchant=150mastery
finger2=nightborne_signet_ring,id=134279,bonus_id=3432/1517/3337,enchant=200mastery
trinket1=naraxas_spiked_tongue,id=137349,bonus_id=3412/1512/3336
trinket2=mana_crystal_shard,id=134335,bonus_id=3432/605/1502/3336
main_hand=thasdorah_legacy_of_the_windrunners,id=128826,bonus_id=727,gem_id=137008/139254/136973/0,relic_id=1807:1472/3379:1467:3336/1727:1502:3336/0

# Gear Summary
# gear_ilvl=859.53
# gear_agility=13383
# gear_stamina=21497
# gear_crit_rating=2005
# gear_haste_rating=4215
# gear_mastery_rating=12100
# gear_versatility_rating=775
# gear_armor=2603
summon_pet=cat

Mellarene

Mellarene : 375159 dps, 247207 dps to main target

  • Race: Blood Elf
  • Class: Mage
  • Spec: Fire
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
375159.2 375159.2 452.1 / 0.121% 87122.7 / 23.2% 23.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
15791.5 15791.5 Mana 3.17% 48.9 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Mellarene/advanced
Talents
  • 15: Conflagration (Fire Mage)
  • 30: Shimmer
  • 45: Rune of Power
  • 60: Flame On (Fire Mage)
  • 75: Ice Floes
  • 90: Living Bomb (Fire Mage)
  • 100: Kindling (Fire Mage)
  • Talent Calculator
Artifact
Professions
  • alchemy: 325
  • herbalism: 768
Scale Factors for Mellarene Damage Per Second
Int Vers Haste Crit Mastery
Scale Factors 10.13 9.03 8.08 6.90 5.39
Normalized 1.00 0.89 0.80 0.68 0.53
Scale Deltas 1138 1138 1138 1138 1138
Error 0.57 0.57 0.57 0.57 0.56
Gear Ranking
Optimizers
Ranking
  • Int > Vers > Haste > Crit > Mastery
Pawn string ( Pawn: v1: "Mellarene": Intellect=10.13, CritRating=6.90, HasteRating=8.08, MasteryRating=5.39, Versatility=9.03 )

Scale Factors for other metrics

Scale Factors for Mellarene Damage Per Second
Int Vers Haste Crit Mastery
Scale Factors 10.13 9.03 8.08 6.90 5.39
Normalized 1.00 0.89 0.80 0.68 0.53
Scale Deltas 1138 1138 1138 1138 1138
Error 0.57 0.57 0.57 0.57 0.56
Gear Ranking
Optimizers
Ranking
  • Int > Vers > Haste > Crit > Mastery
Pawn string ( Pawn: v1: "Mellarene": Intellect=10.13, CritRating=6.90, HasteRating=8.08, MasteryRating=5.39, Versatility=9.03 )
Scale Factors for Mellarene Priority Target Damage Per Second
Crit Int Haste Vers Mastery
Scale Factors 7.92 7.14 6.12 6.03 5.19
Normalized 1.11 1.00 0.86 0.84 0.73
Scale Deltas 1138 1138 1138 1138 1138
Error 0.23 0.22 0.23 0.22 0.22
Gear Ranking
Optimizers
Ranking
  • Crit > Int > Haste ~= Vers > Mastery
Pawn string ( Pawn: v1: "Mellarene": Intellect=7.14, CritRating=7.92, HasteRating=6.12, MasteryRating=5.19, Versatility=6.03 )
Scale Factors for Mellarene Damage Per Second (Effective)
Int Vers Haste Crit Mastery
Scale Factors 10.13 9.03 8.08 6.90 5.39
Normalized 1.00 0.89 0.80 0.68 0.53
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Int > Vers > Haste > Crit > Mastery
Pawn string ( Pawn: v1: "Mellarene": Intellect=10.13, CritRating=6.90, HasteRating=8.08, MasteryRating=5.39, Versatility=9.03 )
Scale Factors for Mellarene Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for MellareneTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Mellarene 375159
Conflagration (_dot) 764 0.2% 92.5 4.13sec 3312 0 Periodic 177.5 1727 0 1727 0.0% 86.8%

Stats details: conflagration_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.53 0.00 177.48 177.48 0.0000 1.9592 306481.25 306481.25 0.00 881.42 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 177.5 100.00% 1726.86 1 2495 1725.79 1653 1806 306481 306481 0.00
 
 

Action details: conflagration_dot

Static Values
  • id:226757
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball also applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=1} Fire damage to nearby enemies.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.050000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Conflagration (_explosion) 21420 5.7% 67.9 5.69sec 124707 0 Direct 307.8 14034 34426 27526 66.2%  

Stats details: conflagration_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.95 307.83 0.00 0.00 0.0000 0.0000 8473536.95 8473536.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.16 33.84% 14034.46 13310 19965 14038.55 13310 17469 1461882 1461882 0.00
crit 203.67 66.16% 34426.16 27685 51909 34404.09 30301 42980 7011655 7011655 0.00
 
 

Action details: conflagration_explosion

Static Values
  • id:205023
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205023
  • name:Conflagration
  • school:fire
  • tooltip:
  • description:Fireball also applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=1} Fire damage to nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 10944 2.9% 20.9 5.47sec 206445 0 Direct 20.9 85960 237907 206832 79.6%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.93 20.89 0.00 0.00 0.0000 0.0000 4320648.31 4320648.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.27 20.45% 85960.46 80804 121206 85420.73 0 121206 367198 367198 0.00
crit 16.62 79.55% 237907.45 161608 303015 238185.08 197717 287956 3953451 3953451 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Fire Blast 15380 4.1% 45.4 8.88sec 135693 0 Direct 45.4 0 135693 135693 100.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.39 45.39 0.00 0.00 0.0000 0.0000 6159144.90 6159144.90 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 45.39 100.00% 135693.38 96888 181666 135618.03 120444 150304 6159145 6159145 0.00
 
 

Action details: fire_blast

Static Values
  • id:108853
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.up
Spelldata
  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. Castable while casting other spells.$?a231568[ Always deals a critical strike.][]$?a231567[ Maximum ${{$231567s1=1}+1} charges.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Fireball 28126 7.6% 92.7 4.13sec 121867 63739 Direct 92.5 64286 145738 122077 71.0%  

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.69 92.53 0.00 0.00 1.9120 0.0000 11295520.76 11295520.76 0.00 63739.08 63739.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.88 29.05% 64286.42 63468 95202 64284.91 63468 71084 1727957 1727957 0.00
crit 65.65 70.95% 145738.04 132013 247524 145692.72 137653 158887 9567564 9567564 0.00
 
 

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Mastery: Ignite (ignite) 52261 14.0% 303.4 1.36sec 69013 0 Periodic 678.3 30867 0 30867 0.0% 169.3%

Stats details: ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 303.36 0.00 678.26 678.26 0.0000 1.0000 20936045.88 20936045.88 0.00 30867.20 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 678.3 100.00% 30866.92 855 222421 31033.99 20083 45056 20936046 20936046 0.00
 
 

Action details: ignite

Static Values
  • id:12846
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12846
  • name:Mastery: Ignite
  • school:physical
  • tooltip:
  • description:Your target burns for an additional $m1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Every $t3 sec, your Ignites may spread to another nearby enemy.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Living Bomb 12117 3.2% 89.1 9.11sec 53682 193870 Periodic 298.9 8499 20239 16008 64.0% 65.5%

Stats details: living_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.13 0.00 298.91 298.91 0.2769 0.8783 4784905.49 4784905.49 0.00 16660.30 193870.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 107.7 36.04% 8499.25 8319 12479 8498.56 8319 9479 915709 915709 0.00
crit 191.2 63.96% 20239.43 17304 32444 20228.47 18139 23200 3869197 3869197 0.00
 
 

Action details: living_bomb

Static Values
  • id:44457
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:16500.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&buff.combustion.down
Spelldata
  • id:44457
  • name:Living Bomb
  • school:fire
  • tooltip:Causes $w1 Fire damage every $t1 sec. After {$d=0 milliseconds}, the target explodes, causing $w2 Fire damage to the target and all other enemies within $44461A2 yards$?$w3>0[, and spreading Living Bomb][].
  • description:The target becomes a Living Bomb, taking $217694o1 Fire damage over {$217694d=4 seconds}, and then exploding to deal an additional {$44461s2=1} Fire damage to the target and all other enemies within $44461A2 yards. Other enemies hit by this explosion also become a Living Bomb, but this effect cannot spread further.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Living Bomb (_explosion) 62885 16.6% 89.1 9.09sec 278625 0 Direct 481.1 27246 65313 51619 64.0%  

Stats details: living_bomb_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.13 481.11 0.00 0.00 0.0000 0.0000 24834782.94 24834782.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.07 35.97% 27245.79 26619 39928 27245.08 26619 30516 4715525 4715525 0.00
crit 308.04 64.03% 65312.97 55367 103813 65259.47 57136 76783 20119258 20119258 0.00
 
 

Action details: living_bomb_explosion

Static Values
  • id:44461
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:44461
  • name:Living Bomb
  • school:fire
  • tooltip:
  • description:{$@spelldesc44457=The target becomes a Living Bomb, taking $217694o1 Fire damage over {$217694d=4 seconds}, and then exploding to deal an additional {$44461s2=1} Fire damage to the target and all other enemies within $44461A2 yards. Other enemies hit by this explosion also become a Living Bomb, but this effect cannot spread further.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Mark of the Hidden Satyr 9163 2.5% 21.3 18.62sec 171949 0 Direct 21.3 86368 214936 171953 66.6%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.34 21.34 0.00 0.00 0.0000 0.0000 3669269.86 3669269.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.13 33.43% 86368.39 82823 124234 86289.35 0 124234 616196 616196 0.00
crit 14.20 66.57% 214935.86 172271 323009 214764.86 172271 323009 3053074 3053074 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Phoenix Reborn 3598 1.0% 41.5 9.44sec 34644 0 Direct 41.5 17407 43262 34644 66.7%  

Stats details: phoenix_reborn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.49 41.49 0.00 0.00 0.0000 0.0000 1437218.03 1437218.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.83 33.33% 17407.38 16636 24954 17412.83 16636 22181 240714 240714 0.00
crit 27.66 66.67% 43261.91 34603 64881 43285.39 37890 49540 1196504 1196504 0.00
 
 

Action details: phoenix_reborn

Static Values
  • id:215773
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215773
  • name:Phoenix Reborn
  • school:fire
  • tooltip:
  • description:Targets affected by your Ignite have a chance to erupt in flame, taking $215775m1 additional Fire damage and reducing the remaining cooldown on Phoenix's Flame by {$s1=10} sec.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Phoenix's Flames 15304 4.1% 19.4 21.25sec 315228 238293 Direct 19.4 0 315999 315999 100.0%  

Stats details: phoenixs_flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.41 19.36 0.00 0.00 1.3229 0.0000 6117225.37 6117225.37 0.00 238293.22 238293.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 19.36 100.00% 315999.25 207620 389288 315930.93 271558 370797 6117225 6117225 0.00
 
 

Action details: phoenixs_flames

Static Values
  • id:194466
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194466
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Phoenix's Flames (_splash) 11802 3.1% 19.4 21.28sec 240801 0 Direct 48.1 0 96822 96822 100.0%  

Stats details: phoenixs_flames_splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.36 48.14 0.00 0.00 0.0000 0.0000 4661475.24 4661475.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 48.14 100.00% 96822.02 72666 129761 96947.02 78549 122841 4661475 4661475 0.00
 
 

Action details: phoenixs_flames_splash

Static Values
  • id:224637
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224637
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc194466=Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Pyroblast 82746 22.2% 97.1 4.13sec 341365 256806 Direct 97.9 144800 394215 338511 77.7%  

Stats details: pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.12 97.94 0.00 0.00 1.3293 0.0000 33153420.18 33153420.18 0.00 256806.17 256806.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.87 22.33% 144800.07 135112 202669 144725.85 135112 163261 3167124 3167124 0.00
crit 76.07 77.67% 394215.23 281034 526939 394251.91 356328 442189 29986297 29986297 0.00
 
 

Action details: pyroblast

Static Values
  • id:11366
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:27500.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.760000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Scorch 13 0.0% 0.1 70.47sec 50704 35017 Direct 0.1 0 50704 50704 100.0%  

Stats details: scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.10 0.10 0.00 0.00 1.4543 0.0000 5182.47 5182.47 0.00 35016.69 35016.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 0.10 100.00% 50704.03 34605 64885 4789.07 0 64885 5182 5182 0.00
 
 

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.combustion.remains>cast_time
Spelldata
  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=1} Fire damage. Castable while moving.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Tormenting Cyclone 17846 4.7% 12.7 30.55sec 558142 0 Direct 306.3 12249 28738 23117 65.9%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.69 306.27 0.00 0.00 0.0000 0.0000 7080130.51 7080130.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 104.40 34.09% 12248.80 11844 17766 12245.02 11844 15134 1278744 1278744 0.00
crit 201.87 65.91% 28737.76 23688 44415 28716.17 24814 36536 5801387 5801387 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Volatile Ichor 30792 8.2% 17.0 23.05sec 718100 0 Direct 57.2 114514 266477 213553 65.2%  

Stats details: volatile_ichor

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.02 57.22 0.00 0.00 0.0000 0.0000 12219256.39 12219256.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.93 34.83% 114514.27 110791 166187 114544.70 110791 147722 2281940 2281940 0.00
crit 37.29 65.17% 266477.47 221582 415467 266337.20 226096 348489 9937316 9937316 0.00
 
 

Action details: volatile_ichor

Static Values
  • id:222187
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222187
  • name:Volatile Ichor
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a Volatile Ichor, which creeps towards the target and explodes on contact, dealing {$s1=65033} Nature damage within $222197A1 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:108554.62
  • base_dd_max:108554.62
 
Simple Action Stats Execute Interval
Mellarene
Arcane Torrent 3.8 117.49sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.82 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:28730
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:28730
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and restore {$s2=3}% of your Mana. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mellarene
  • harmful:false
  • if_expr:
 
Combustion 5.3 83.42sec

Stats details: combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.31 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: combustion

Static Values
  • id:190319
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:110000.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Castable while casting other spells.
 
Counterspell 9.1 46.14sec

Stats details: counterspell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.10 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: counterspell

Static Values
  • id:2139
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.debuff.casting.react
Spelldata
  • id:2139
  • name:Counterspell
  • school:arcane
  • tooltip:
  • description:Counters the enemy's spellcast, preventing any spell from that school of magic from being cast for {$d=6 seconds}$?s12598[ and silencing the target for $55021d][].
 
Flame On 5.7 80.06sec

Stats details: flame_on

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.70 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flame_on

Static Values
  • id:205029
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
Spelldata
  • id:205029
  • name:Flame On
  • school:fire
  • tooltip:
  • description:Immediately grants {$s1=2} charges of Fire Blast.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mellarene
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mellarene
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rune of Power 8.8 50.35sec

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.75 0.00 0.00 0.00 1.5462 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 40.03% 0.0(0.0) 1.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 5.3 0.0 83.4sec 83.4sec 13.11% 90.47% 104.9(104.9) 5.2

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_combustion
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • combustion_1:13.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Enhanced Pyrotechnics 21.9 5.0 17.3sec 14.0sec 26.40% 27.76% 0.0(0.0) 1.1

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_enhanced_pyrotechnics
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • enhanced_pyrotechnics_1:22.49%
  • enhanced_pyrotechnics_2:3.56%
  • enhanced_pyrotechnics_3:0.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157644
  • name:Enhanced Pyrotechnics
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%.
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Heating Up 106.8 0.0 3.8sec 3.8sec 41.46% 47.68% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_heating_up
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • heating_up_1:41.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 97.3 0.0 4.1sec 4.1sec 21.00% 98.96% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hot_streak_1:21.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 82.0sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Pyretic Incantation 39.6 167.0 10.1sec 1.9sec 74.25% 100.00% 78.8(78.8) 1.2

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_pyretic_incantation
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • pyretic_incantation_1:17.89%
  • pyretic_incantation_2:9.93%
  • pyretic_incantation_3:6.52%
  • pyretic_incantation_4:8.25%
  • pyretic_incantation_5:31.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194329
  • name:Pyretic Incantation
  • tooltip:Your spells deal an additional $m1% critical hit damage.
  • description:Your spells deal an additional $m1% critical hit damage.
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.52% 14.52% 2.0(2.0) 0.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.52%

Trigger Attempt Success

  • trigger_pct:100.00%
Rune of Power 8.8 0.0 50.2sec 50.2sec 14.26% 14.26% 0.0(0.0) 2.5

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rune_of_power_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Armor

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_molten_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • molten_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:30482
  • name:Molten Armor
  • tooltip:Spell critical strike chance increased by $w1%. Physical damage taken reduced by $w2%.
  • description:Increases your spell critical strike chance by {$s1=10}% and reduces all Physical damage you take by {$s2=6}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mellarene
combustion Mana 5.3 584012.8 110000.0 109997.4 0.0
counterspell Mana 9.1 200203.7 22000.0 21999.7 0.0
fire_blast Mana 45.4 499295.3 11000.0 11000.0 12.3
fireball Mana 92.7 2039138.1 22000.0 22000.2 5.5
living_bomb Mana 18.4 304309.0 16500.0 3414.1 15.7
pyroblast Mana 98.1 2698271.5 27500.0 27782.8 12.3
scorch Mana 0.1 1123.9 11000.0 10995.6 4.6
Resource Gains Type Count Total Average Overflow
arcane_torrent Mana 3.82 123662.04 (1.98%) 32388.76 2333.76 1.85%
mp5_regen Mana 841.39 6135606.61 (98.02%) 7292.21 467652.00 7.08%
Resource RPS-Gain RPS-Loss
Mana 15623.97 15791.48
Combat End Resource Mean Min Max
Mana 1033095.64 901719.50 1100000.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.2%

Procs

Count Interval
Heating Up generated 106.8 3.8sec
Heating Up removed 9.0 38.5sec
IB conversions of HU 43.6 9.2sec
Total Hot Streak procs 97.3 4.1sec
Hot Streak spells used 255.3 1.6sec
Hot Streak spell crits 206.6 1.9sec
Wasted Hot Streak spell crits 2.5 73.6sec
Direct Ignite applications 31.6 42.8sec
Ignites spread 1.0 0.0sec

Statistics & Data Analysis

Fight Length
Sample Data Mellarene Fight Length
Count 9999
Mean 400.62
Minimum 307.54
Maximum 499.01
Spread ( max - min ) 191.47
Range [ ( max - min ) / 2 * 100% ] 23.90%
DPS
Sample Data Mellarene Damage Per Second
Count 9999
Mean 375159.23
Minimum 309264.16
Maximum 472211.06
Spread ( max - min ) 162946.90
Range [ ( max - min ) / 2 * 100% ] 21.72%
Standard Deviation 23065.6515
5th Percentile 341155.01
95th Percentile 415608.39
( 95th Percentile - 5th Percentile ) 74453.37
Mean Distribution
Standard Deviation 230.6680
95.00% Confidence Intervall ( 374707.13 - 375611.33 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 145
0.1% Error 14520
0.1 Scale Factor Error with Delta=300 4541665
0.05 Scale Factor Error with Delta=300 18166661
0.01 Scale Factor Error with Delta=300 454166526
Priority Target DPS
Sample Data Mellarene Priority Target Damage Per Second
Count 9999
Mean 247207.22
Minimum 215424.71
Maximum 292035.76
Spread ( max - min ) 76611.05
Range [ ( max - min ) / 2 * 100% ] 15.50%
Standard Deviation 8765.7653
5th Percentile 233492.82
95th Percentile 262005.92
( 95th Percentile - 5th Percentile ) 28513.10
Mean Distribution
Standard Deviation 87.6620
95.00% Confidence Intervall ( 247035.41 - 247379.04 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4830
0.1 Scale Factor Error with Delta=300 655938
0.05 Scale Factor Error with Delta=300 2623755
0.01 Scale Factor Error with Delta=300 65593884
DPS(e)
Sample Data Mellarene Damage Per Second (Effective)
Count 9999
Mean 375159.23
Minimum 309264.16
Maximum 472211.06
Spread ( max - min ) 162946.90
Range [ ( max - min ) / 2 * 100% ] 21.72%
Damage
Sample Data Mellarene Damage
Count 9999
Mean 149454244.52
Minimum 112513433.83
Maximum 186894743.95
Spread ( max - min ) 74381310.12
Range [ ( max - min ) / 2 * 100% ] 24.88%
DTPS
Sample Data Mellarene Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mellarene Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mellarene Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mellarene Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mellarene Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mellarene Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MellareneTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mellarene Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 mirror_image
5 0.00 potion,name=deadly_grace
6 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
7 9.10 counterspell,if=target.debuff.casting.react
0.00 time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
0.00 mirror_image,if=buff.combustion.down
8 6.39 rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
9 0.00 call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
A 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
B 0.00 call_action_list,name=single_target
actions.active_talents
# count action,conditions
C 5.70 flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
0.00 blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
0.00 meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
0.00 cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
0.00 dragons_breath,if=equipped.132863
D 18.45 living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase
# count action,conditions
E 4.51 rune_of_power,if=buff.combustion.down
F 0.00 call_action_list,name=active_talents
G 5.31 combustion
H 1.00 potion,name=deadly_grace
0.00 blood_fury
0.00 berserking
I 3.82 arcane_torrent
J 31.22 pyroblast,if=buff.hot_streak.up
K 20.78 fire_blast,if=buff.heating_up.up
L 11.72 phoenixs_flames
M 0.13 scorch,if=buff.combustion.remains>cast_time
0.00 scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase
# count action,conditions
0.00 rune_of_power
N 9.68 pyroblast,if=buff.hot_streak.up
O 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.kaelthas_ultimate_ability.react
P 5.37 fire_blast,if=!prev_off_gcd.fire_blast
Q 5.15 phoenixs_flames,if=!prev_gcd.phoenixs_flames
0.00 scorch,if=target.health.pct<=25&equipped.132454
R 3.78 fireball
actions.single_target
# count action,conditions
0.00 pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
S 2.23 phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
0.00 flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
T 56.22 pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
0.00 pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
0.00 pyroblast,if=buff.kaelthas_ultimate_ability.react
U 0.00 call_action_list,name=active_talents
V 0.19 fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
W 19.05 fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
X 0.31 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
0.00 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
0.00 scorch,if=target.health.pct<=25&equipped.132454
Y 106.70 fireball

Sample Sequence

01256EGILKJKCJ7KJKJLJLJY8PNRQNRDYYYWTYTDYWTYTYTY7TYTWYTYDWTYYYWTYYTDTYYYYYEGHKJKCJKJ7KJLJLJDYYTYTWYTYYTYDWT87QNPQNQRRDYYYTYTYTDTYYWTYYT7YTDTYYEGIJKJKCJKJKJLJLTDYYTYWTYY7YYTWY8NDYYWTYTYTYSTDWTYWTY7YTDYSTYYTYTEDGKJKCJKJKJILJLJDYYTYYWTYTDY8PNQNYY7YTDWTYYYYYWTYTDTYYWTYYYYTYTYEGJKJKCJKJ7KJLJLTYYTYYTYTWYTYYT8PNQNPNRQ7RYTY8PCRPNNPNR

Sample Sequence Table

time name target resources buffs
Pre flask Mellarene 1100000.0/1100000: 100% mana
Pre food Mellarene 1100000.0/1100000: 100% mana
Pre augmentation Mellarene 1100000.0/1100000: 100% mana
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana potion_of_deadly_grace
0:00.000 pyroblast Fluffy_Pillow 1072500.0/1100000: 98% mana potion_of_deadly_grace
0:00.000 rune_of_power Fluffy_Pillow 1072500.0/1100000: 98% mana potion_of_deadly_grace
0:01.373 combustion Fluffy_Pillow 1095154.5/1100000: 100% mana bloodlust, rune_of_power, potion_of_deadly_grace
0:01.373 arcane_torrent Fluffy_Pillow 985154.5/1100000: 90% mana bloodlust, combustion, rune_of_power, potion_of_deadly_grace
0:01.373 phoenixs_flames Fluffy_Pillow 1018154.5/1100000: 93% mana bloodlust, combustion, rune_of_power, potion_of_deadly_grace
0:02.431 fire_blast Fluffy_Pillow 1035611.5/1100000: 94% mana bloodlust, combustion, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
0:02.431 pyroblast Fluffy_Pillow 1024611.5/1100000: 93% mana bloodlust, combustion, hot_streak, pyretic_incantation(2), rune_of_power, potion_of_deadly_grace
0:03.487 fire_blast Fluffy_Pillow 1014535.5/1100000: 92% mana bloodlust, combustion, heating_up, pyretic_incantation(3), rune_of_power, potion_of_deadly_grace
0:03.487 flame_on Fluffy_Pillow 1003535.5/1100000: 91% mana bloodlust, combustion, hot_streak, pyretic_incantation(4), rune_of_power, potion_of_deadly_grace
0:03.487 pyroblast Fluffy_Pillow 1003535.5/1100000: 91% mana bloodlust, combustion, hot_streak, pyretic_incantation(4), rune_of_power, potion_of_deadly_grace
0:04.544 counterspell Fluffy_Pillow 993476.0/1100000: 90% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:04.544 fire_blast Fluffy_Pillow 971476.0/1100000: 88% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:04.544 pyroblast Fluffy_Pillow 960476.0/1100000: 87% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:05.600 fire_blast Fluffy_Pillow 950400.0/1100000: 86% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:05.600 pyroblast Fluffy_Pillow 939400.0/1100000: 85% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:06.656 phoenixs_flames Fluffy_Pillow 929324.0/1100000: 84% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:07.711 pyroblast Fluffy_Pillow 946731.5/1100000: 86% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:08.766 phoenixs_flames Fluffy_Pillow 936639.0/1100000: 85% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:09.821 pyroblast Fluffy_Pillow 954046.5/1100000: 87% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:10.879 fireball Fluffy_Pillow 944003.5/1100000: 86% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:12.003 Waiting 1.200 sec 962549.5/1100000: 88% mana bloodlust, raid_movement, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:13.203 rune_of_power Fluffy_Pillow 982349.5/1100000: 89% mana bloodlust, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:14.257 fire_blast Fluffy_Pillow 999740.5/1100000: 91% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:14.257 pyroblast Fluffy_Pillow 988740.5/1100000: 90% mana bloodlust, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:15.314 fireball Fluffy_Pillow 978681.0/1100000: 89% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:16.752 phoenixs_flames Fluffy_Pillow 980408.0/1100000: 89% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:17.808 pyroblast Fluffy_Pillow 997832.0/1100000: 91% mana bloodlust, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:18.864 fireball Fluffy_Pillow 987756.0/1100000: 90% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:20.004 living_bomb Fluffy_Pillow 1006566.0/1100000: 92% mana bloodlust, raid_movement, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:21.061 Waiting 2.600 sec 1007506.5/1100000: 92% mana bloodlust, raid_movement, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:23.661 fireball Fluffy_Pillow 1050406.5/1100000: 95% mana bloodlust, heating_up, pyretic_incantation(5)
0:25.099 fireball Fluffy_Pillow 1052133.5/1100000: 96% mana bloodlust, heating_up
0:26.539 fireball Fluffy_Pillow 1053893.5/1100000: 96% mana bloodlust, enhanced_pyrotechnics
0:27.978 fire_blast Fluffy_Pillow 1055637.0/1100000: 96% mana bloodlust, heating_up, pyretic_incantation
0:27.978 pyroblast Fluffy_Pillow 1044637.0/1100000: 95% mana bloodlust, hot_streak, pyretic_incantation(2)
0:29.035 Waiting 0.200 sec 1034577.5/1100000: 94% mana bloodlust, raid_movement, hot_streak, pyretic_incantation(4)
0:29.235 fireball Fluffy_Pillow 1037877.5/1100000: 94% mana bloodlust, hot_streak, pyretic_incantation(4)
0:30.674 pyroblast Fluffy_Pillow 1039621.0/1100000: 95% mana bloodlust, hot_streak, pyretic_incantation(4)
0:31.732 living_bomb Fluffy_Pillow 1029578.0/1100000: 94% mana bloodlust, heating_up
0:32.788 fireball Fluffy_Pillow 1030502.0/1100000: 94% mana bloodlust, heating_up
0:34.227 fire_blast Fluffy_Pillow 1032245.5/1100000: 94% mana bloodlust, heating_up
0:34.227 pyroblast Fluffy_Pillow 1021245.5/1100000: 93% mana bloodlust, hot_streak, pyretic_incantation
0:35.285 fireball Fluffy_Pillow 1011202.5/1100000: 92% mana bloodlust, hot_streak, pyretic_incantation(3)
0:36.724 pyroblast Fluffy_Pillow 1012946.0/1100000: 92% mana bloodlust, hot_streak, pyretic_incantation(3)
0:37.781 fireball Fluffy_Pillow 1002886.5/1100000: 91% mana bloodlust, hot_streak, pyretic_incantation(5)
0:39.220 pyroblast Fluffy_Pillow 1004630.0/1100000: 91% mana bloodlust, hot_streak, pyretic_incantation(5)
0:40.276 fireball Fluffy_Pillow 994554.0/1100000: 90% mana bloodlust, hot_streak, pyretic_incantation(5)
0:41.717 counterspell Fluffy_Pillow 996330.5/1100000: 91% mana hot_streak, pyretic_incantation(5)
0:41.717 pyroblast Fluffy_Pillow 974330.5/1100000: 89% mana hot_streak, pyretic_incantation(5)
0:43.090 fireball Fluffy_Pillow 969485.0/1100000: 88% mana hot_streak, pyretic_incantation(5)
0:44.464 pyroblast Fluffy_Pillow 992156.0/1100000: 90% mana raid_movement, hot_streak, pyretic_incantation(5)
0:45.836 fire_blast Fluffy_Pillow 987294.0/1100000: 90% mana heating_up, pyretic_incantation(5)
0:45.836 fireball Fluffy_Pillow 976294.0/1100000: 89% mana hot_streak, pyretic_incantation(5)
0:47.709 pyroblast Fluffy_Pillow 985198.5/1100000: 90% mana hot_streak, pyretic_incantation(5)
0:49.082 fireball Fluffy_Pillow 980353.0/1100000: 89% mana heating_up
0:50.454 living_bomb Fluffy_Pillow 1002991.0/1100000: 91% mana raid_movement, heating_up
0:51.826 fire_blast Fluffy_Pillow 1009129.0/1100000: 92% mana raid_movement, heating_up
0:51.826 pyroblast Fluffy_Pillow 998129.0/1100000: 91% mana raid_movement, hot_streak, pyretic_incantation
0:53.196 Waiting 0.400 sec 993234.0/1100000: 90% mana raid_movement, heating_up, pyretic_incantation(2)
0:53.596 fireball Fluffy_Pillow 999834.0/1100000: 91% mana heating_up, pyretic_incantation(2)
0:55.468 fireball Fluffy_Pillow 1008722.0/1100000: 92% mana heating_up, pyretic_incantation(2)
0:57.339 fireball Fluffy_Pillow 1017593.5/1100000: 93% mana enhanced_pyrotechnics
0:59.211 fire_blast Fluffy_Pillow 1026481.5/1100000: 93% mana heating_up, pyretic_incantation
0:59.211 pyroblast Fluffy_Pillow 1015481.5/1100000: 92% mana hot_streak, pyretic_incantation(2)
1:00.584 Waiting 0.600 sec 1010636.0/1100000: 92% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
1:01.184 fireball Fluffy_Pillow 1020536.0/1100000: 93% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:03.056 fireball Fluffy_Pillow 1029424.0/1100000: 94% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:04.928 pyroblast Fluffy_Pillow 1038312.0/1100000: 94% mana hot_streak, pyretic_incantation(2)
1:06.300 living_bomb Fluffy_Pillow 1033450.0/1100000: 94% mana hot_streak, pyretic_incantation(4)
1:07.673 pyroblast Fluffy_Pillow 1039604.5/1100000: 95% mana hot_streak, pyretic_incantation(4)
1:09.045 fireball Fluffy_Pillow 1034742.5/1100000: 94% mana heating_up, pyretic_incantation(5)
1:10.916 fireball Fluffy_Pillow 1043614.0/1100000: 95% mana heating_up, pyretic_incantation(5)
1:12.788 fireball Fluffy_Pillow 1052502.0/1100000: 96% mana enhanced_pyrotechnics
1:14.660 fireball Fluffy_Pillow 1061390.0/1100000: 96% mana heating_up, pyretic_incantation
1:16.031 Waiting 1.200 sec 1084011.5/1100000: 99% mana raid_movement, enhanced_pyrotechnics
1:17.231 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics
1:19.102 rune_of_power Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics
1:20.474 combustion Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, heating_up, pyretic_incantation
1:20.474 potion Fluffy_Pillow 990000.0/1100000: 90% mana raid_movement, combustion, heating_up, pyretic_incantation
1:20.474 fire_blast Fluffy_Pillow 990000.0/1100000: 90% mana raid_movement, combustion, heating_up, pyretic_incantation, potion_of_deadly_grace
1:20.474 pyroblast Fluffy_Pillow 979000.0/1100000: 89% mana raid_movement, combustion, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
1:21.847 fire_blast Fluffy_Pillow 974154.5/1100000: 89% mana raid_movement, combustion, heating_up, pyretic_incantation(3), potion_of_deadly_grace
1:21.847 flame_on Fluffy_Pillow 963154.5/1100000: 88% mana raid_movement, combustion, hot_streak, pyretic_incantation(4), potion_of_deadly_grace
1:21.847 pyroblast Fluffy_Pillow 963154.5/1100000: 88% mana raid_movement, combustion, hot_streak, pyretic_incantation(4), potion_of_deadly_grace
1:23.219 fire_blast Fluffy_Pillow 958292.5/1100000: 87% mana raid_movement, combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:23.219 pyroblast Fluffy_Pillow 947292.5/1100000: 86% mana raid_movement, combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:24.592 counterspell Fluffy_Pillow 942447.0/1100000: 86% mana combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:24.592 fire_blast Fluffy_Pillow 920447.0/1100000: 84% mana combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:24.592 pyroblast Fluffy_Pillow 909447.0/1100000: 83% mana combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:25.966 phoenixs_flames Fluffy_Pillow 904618.0/1100000: 82% mana combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:27.338 pyroblast Fluffy_Pillow 927256.0/1100000: 84% mana combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:28.711 phoenixs_flames Fluffy_Pillow 922410.5/1100000: 84% mana combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:30.086 pyroblast Fluffy_Pillow 945098.0/1100000: 86% mana combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:31.458 living_bomb Fluffy_Pillow 940236.0/1100000: 85% mana heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:32.830 Waiting 0.400 sec 946374.0/1100000: 86% mana raid_movement, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:33.230 fireball Fluffy_Pillow 952974.0/1100000: 87% mana heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:35.101 fireball Fluffy_Pillow 961845.5/1100000: 87% mana heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:36.973 pyroblast Fluffy_Pillow 970733.5/1100000: 88% mana hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:38.345 fireball Fluffy_Pillow 965871.5/1100000: 88% mana hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:40.216 pyroblast Fluffy_Pillow 974743.0/1100000: 89% mana hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:41.588 fire_blast Fluffy_Pillow 969881.0/1100000: 88% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, potion_of_deadly_grace
1:41.588 fireball Fluffy_Pillow 958881.0/1100000: 87% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
1:43.459 pyroblast Fluffy_Pillow 967752.5/1100000: 88% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
1:44.831 fireball Fluffy_Pillow 962890.5/1100000: 88% mana heating_up, potion_of_deadly_grace
1:46.703 fireball Fluffy_Pillow 971778.5/1100000: 88% mana heating_up
1:48.074 pyroblast Fluffy_Pillow 994400.0/1100000: 90% mana raid_movement, hot_streak, pyretic_incantation
1:49.446 fireball Fluffy_Pillow 989538.0/1100000: 90% mana heating_up, pyretic_incantation(2)
1:50.818 living_bomb Fluffy_Pillow 1012176.0/1100000: 92% mana raid_movement, heating_up, pyretic_incantation(2)
1:52.192 fire_blast Fluffy_Pillow 1018347.0/1100000: 93% mana raid_movement, heating_up, pyretic_incantation(2)
1:52.192 pyroblast Fluffy_Pillow 1007347.0/1100000: 92% mana raid_movement, hot_streak, pyretic_incantation(3)
1:53.564 Waiting 0.100 sec 1002485.0/1100000: 91% mana raid_movement, heating_up, pyretic_incantation(4)
1:53.664 rune_of_power Fluffy_Pillow 1004135.0/1100000: 91% mana heating_up, pyretic_incantation(4)
1:55.037 counterspell Fluffy_Pillow 1026789.5/1100000: 93% mana heating_up, pyretic_incantation(4), rune_of_power
1:55.037 phoenixs_flames Fluffy_Pillow 1004789.5/1100000: 91% mana heating_up, pyretic_incantation(4), rune_of_power
1:56.409 pyroblast Fluffy_Pillow 1027427.5/1100000: 93% mana hot_streak, pyretic_incantation(5), rune_of_power
1:57.781 fire_blast Fluffy_Pillow 1022565.5/1100000: 93% mana rune_of_power
1:57.781 phoenixs_flames Fluffy_Pillow 1011565.5/1100000: 92% mana heating_up, pyretic_incantation, rune_of_power
1:59.154 pyroblast Fluffy_Pillow 1034220.0/1100000: 94% mana hot_streak, pyretic_incantation(2), rune_of_power
2:00.526 phoenixs_flames Fluffy_Pillow 1029358.0/1100000: 94% mana rune_of_power
2:01.898 fireball Fluffy_Pillow 1051996.0/1100000: 96% mana heating_up, pyretic_incantation, rune_of_power
2:03.767 fireball Fluffy_Pillow 1060834.5/1100000: 96% mana heating_up, pyretic_incantation, rune_of_power
2:05.139 Waiting 0.100 sec 1083472.5/1100000: 98% mana raid_movement, enhanced_pyrotechnics
2:05.239 living_bomb Fluffy_Pillow 1085122.5/1100000: 99% mana enhanced_pyrotechnics
2:06.783 fireball Fluffy_Pillow 1094098.5/1100000: 99% mana enhanced_pyrotechnics
2:08.653 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana enhanced_pyrotechnics
2:10.524 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
2:12.397 pyroblast Fluffy_Pillow 1078099.0/1100000: 98% mana hot_streak, pyretic_incantation(2)
2:13.769 fireball Fluffy_Pillow 1073237.0/1100000: 98% mana hot_streak, pyretic_incantation(4)
2:15.640 pyroblast Fluffy_Pillow 1078066.0/1100000: 98% mana hot_streak, pyretic_incantation(4)
2:17.012 fireball Fluffy_Pillow 1073204.0/1100000: 98% mana hot_streak, pyretic_incantation(5)
2:18.883 pyroblast Fluffy_Pillow 1078066.0/1100000: 98% mana hot_streak, pyretic_incantation(5)
2:20.254 living_bomb Fluffy_Pillow 1073187.5/1100000: 98% mana raid_movement, hot_streak, pyretic_incantation(5)
2:21.625 pyroblast Fluffy_Pillow 1079309.0/1100000: 98% mana hot_streak, pyretic_incantation(5)
2:22.997 fireball Fluffy_Pillow 1074447.0/1100000: 98% mana
2:24.868 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana
2:26.740 fire_blast Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation
2:26.740 pyroblast Fluffy_Pillow 1067082.5/1100000: 97% mana hot_streak, pyretic_incantation(2)
2:28.113 fireball Fluffy_Pillow 1062237.0/1100000: 97% mana heating_up
2:29.986 fireball Fluffy_Pillow 1071141.5/1100000: 97% mana heating_up
2:31.858 pyroblast Fluffy_Pillow 1078082.5/1100000: 98% mana hot_streak, pyretic_incantation
2:33.230 counterspell Fluffy_Pillow 1073220.5/1100000: 98% mana hot_streak, pyretic_incantation(3)
2:33.230 fireball Fluffy_Pillow 1051220.5/1100000: 96% mana hot_streak, pyretic_incantation(3)
2:35.100 pyroblast Fluffy_Pillow 1060075.5/1100000: 96% mana hot_streak, pyretic_incantation(3)
2:36.473 living_bomb Fluffy_Pillow 1055230.0/1100000: 96% mana raid_movement, hot_streak, pyretic_incantation(5)
2:37.847 pyroblast Fluffy_Pillow 1061401.0/1100000: 96% mana hot_streak, pyretic_incantation(5)
2:39.221 fireball Fluffy_Pillow 1056572.0/1100000: 96% mana
2:41.092 fireball Fluffy_Pillow 1065443.5/1100000: 97% mana
2:42.964 rune_of_power Fluffy_Pillow 1074331.5/1100000: 98% mana heating_up, pyretic_incantation
2:44.337 combustion Fluffy_Pillow 1096986.0/1100000: 100% mana hot_streak, pyretic_incantation(2), rune_of_power
2:44.337 arcane_torrent Fluffy_Pillow 986986.0/1100000: 90% mana combustion, hot_streak, pyretic_incantation(2), rune_of_power
2:44.337 pyroblast Fluffy_Pillow 1019986.0/1100000: 93% mana combustion, hot_streak, pyretic_incantation(2), rune_of_power
2:45.708 fire_blast Fluffy_Pillow 1015107.5/1100000: 92% mana combustion, heating_up, pyretic_incantation(3), rune_of_power
2:45.708 pyroblast Fluffy_Pillow 1004107.5/1100000: 91% mana combustion, hot_streak, pyretic_incantation(4), rune_of_power
2:47.081 fire_blast Fluffy_Pillow 999262.0/1100000: 91% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
2:47.081 flame_on Fluffy_Pillow 988262.0/1100000: 90% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
2:47.081 pyroblast Fluffy_Pillow 988262.0/1100000: 90% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
2:48.455 fire_blast Fluffy_Pillow 983433.0/1100000: 89% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
2:48.455 pyroblast Fluffy_Pillow 972433.0/1100000: 88% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
2:49.826 fire_blast Fluffy_Pillow 967554.5/1100000: 88% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
2:49.826 pyroblast Fluffy_Pillow 956554.5/1100000: 87% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
2:51.200 phoenixs_flames Fluffy_Pillow 951725.5/1100000: 87% mana raid_movement, combustion, heating_up, pyretic_incantation(5), rune_of_power
2:52.572 pyroblast Fluffy_Pillow 974363.5/1100000: 89% mana raid_movement, combustion, hot_streak, pyretic_incantation(5)
2:53.943 phoenixs_flames Fluffy_Pillow 969485.0/1100000: 88% mana combustion, heating_up, pyretic_incantation(5)
2:55.316 pyroblast Fluffy_Pillow 992139.5/1100000: 90% mana hot_streak, pyretic_incantation(5)
2:56.689 living_bomb Fluffy_Pillow 987294.0/1100000: 90% mana heating_up, pyretic_incantation(5)
2:58.061 fireball Fluffy_Pillow 993432.0/1100000: 90% mana heating_up, pyretic_incantation(5)
2:59.932 fireball Fluffy_Pillow 1002303.5/1100000: 91% mana heating_up, pyretic_incantation(5)
3:01.803 pyroblast Fluffy_Pillow 1011175.0/1100000: 92% mana hot_streak, pyretic_incantation(5)
3:03.176 fireball Fluffy_Pillow 1006329.5/1100000: 91% mana heating_up
3:05.049 fire_blast Fluffy_Pillow 1015234.0/1100000: 92% mana heating_up
3:05.049 pyroblast Fluffy_Pillow 1004234.0/1100000: 91% mana hot_streak, pyretic_incantation
3:06.421 fireball Fluffy_Pillow 999372.0/1100000: 91% mana enhanced_pyrotechnics
3:08.003 Waiting 1.200 sec 1025475.0/1100000: 93% mana raid_movement, enhanced_pyrotechnics
3:09.203 fireball Fluffy_Pillow 1045275.0/1100000: 95% mana enhanced_pyrotechnics
3:11.077 counterspell Fluffy_Pillow 1054196.0/1100000: 96% mana enhanced_pyrotechnics
3:11.077 fireball Fluffy_Pillow 1032196.0/1100000: 94% mana enhanced_pyrotechnics
3:12.949 fireball Fluffy_Pillow 1041084.0/1100000: 95% mana heating_up, pyretic_incantation
3:14.820 pyroblast Fluffy_Pillow 1049955.5/1100000: 95% mana hot_streak, pyretic_incantation(2)
3:16.193 fire_blast Fluffy_Pillow 1045110.0/1100000: 95% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:16.193 fireball Fluffy_Pillow 1034110.0/1100000: 94% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
3:18.064 rune_of_power Fluffy_Pillow 1042981.5/1100000: 95% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
3:19.434 pyroblast Fluffy_Pillow 1065586.5/1100000: 97% mana hot_streak, pyretic_incantation(3), rune_of_power
3:20.808 living_bomb Fluffy_Pillow 1060757.5/1100000: 96% mana raid_movement, heating_up, pyretic_incantation(4), rune_of_power
3:22.180 Waiting 1.400 sec 1066895.5/1100000: 97% mana raid_movement, heating_up, pyretic_incantation(4)
3:23.580 fireball Fluffy_Pillow 1089995.5/1100000: 99% mana heating_up, pyretic_incantation(4)
3:24.951 Waiting 0.200 sec 1100000.0/1100000: 100% mana raid_movement, heating_up, pyretic_incantation(4)
3:25.151 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana heating_up, pyretic_incantation(4)
3:27.022 fire_blast Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up
3:27.022 pyroblast Fluffy_Pillow 1067066.0/1100000: 97% mana hot_streak, pyretic_incantation
3:28.394 fireball Fluffy_Pillow 1062204.0/1100000: 97% mana hot_streak, pyretic_incantation(3)
3:30.267 pyroblast Fluffy_Pillow 1071108.5/1100000: 97% mana hot_streak, pyretic_incantation(3)
3:31.638 fireball Fluffy_Pillow 1066230.0/1100000: 97% mana hot_streak, pyretic_incantation(5)
3:33.511 pyroblast Fluffy_Pillow 1075134.5/1100000: 98% mana hot_streak, pyretic_incantation(5)
3:34.884 fireball Fluffy_Pillow 1070289.0/1100000: 97% mana enhanced_pyrotechnics
3:36.753 phoenixs_flames Fluffy_Pillow 1078033.0/1100000: 98% mana enhanced_pyrotechnics
3:38.127 pyroblast Fluffy_Pillow 1100000.0/1100000: 100% mana hot_streak, pyretic_incantation(2)
3:39.500 living_bomb Fluffy_Pillow 1095154.5/1100000: 100% mana heating_up, pyretic_incantation(3)
3:40.872 fire_blast Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, heating_up, pyretic_incantation(3)
3:40.872 pyroblast Fluffy_Pillow 1089000.0/1100000: 99% mana raid_movement, hot_streak, pyretic_incantation(4)
3:42.245 fireball Fluffy_Pillow 1084154.5/1100000: 99% mana heating_up, pyretic_incantation(5)
3:44.118 fire_blast Fluffy_Pillow 1078099.0/1100000: 98% mana heating_up, pyretic_incantation(5)
3:44.118 pyroblast Fluffy_Pillow 1067099.0/1100000: 97% mana hot_streak, pyretic_incantation(5)
3:45.491 fireball Fluffy_Pillow 1062253.5/1100000: 97% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:47.361 counterspell Fluffy_Pillow 1071108.5/1100000: 97% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:47.361 fireball Fluffy_Pillow 1049108.5/1100000: 95% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:49.232 pyroblast Fluffy_Pillow 1057980.0/1100000: 96% mana hot_streak, pyretic_incantation(2)
3:50.604 living_bomb Fluffy_Pillow 1053118.0/1100000: 96% mana raid_movement, enhanced_pyrotechnics
3:51.976 Waiting 1.600 sec 1059256.0/1100000: 96% mana raid_movement, enhanced_pyrotechnics
3:53.576 fireball Fluffy_Pillow 1085656.0/1100000: 99% mana enhanced_pyrotechnics
3:55.447 phoenixs_flames Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics
3:56.819 pyroblast Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(2)
3:58.191 fireball Fluffy_Pillow 1095138.0/1100000: 100% mana heating_up, pyretic_incantation(3)
4:00.062 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation(3)
4:01.934 pyroblast Fluffy_Pillow 1078082.5/1100000: 98% mana hot_streak, pyretic_incantation(4)
4:03.306 fireball Fluffy_Pillow 1073220.5/1100000: 98% mana hot_streak, pyretic_incantation(5)
4:05.178 pyroblast Fluffy_Pillow 1078082.5/1100000: 98% mana hot_streak, pyretic_incantation(5)
4:06.548 rune_of_power Fluffy_Pillow 1073187.5/1100000: 98% mana heating_up
4:07.922 living_bomb Fluffy_Pillow 1095858.5/1100000: 100% mana heating_up, rune_of_power
4:09.295 combustion Fluffy_Pillow 1100000.0/1100000: 100% mana heating_up, rune_of_power
4:09.295 fire_blast Fluffy_Pillow 990000.0/1100000: 90% mana combustion, heating_up, rune_of_power
4:09.295 pyroblast Fluffy_Pillow 979000.0/1100000: 89% mana combustion, hot_streak, pyretic_incantation, rune_of_power
4:10.667 fire_blast Fluffy_Pillow 974138.0/1100000: 89% mana combustion, heating_up, pyretic_incantation(2), rune_of_power
4:10.667 flame_on Fluffy_Pillow 963138.0/1100000: 88% mana combustion, hot_streak, pyretic_incantation(3), rune_of_power
4:10.667 pyroblast Fluffy_Pillow 963138.0/1100000: 88% mana combustion, hot_streak, pyretic_incantation(3), rune_of_power
4:12.038 fire_blast Fluffy_Pillow 958259.5/1100000: 87% mana raid_movement, combustion, heating_up, pyretic_incantation(4), rune_of_power
4:12.038 pyroblast Fluffy_Pillow 947259.5/1100000: 86% mana raid_movement, combustion, hot_streak, pyretic_incantation(5), rune_of_power
4:13.410 fire_blast Fluffy_Pillow 942397.5/1100000: 86% mana combustion, heating_up, pyretic_incantation(5)
4:13.410 pyroblast Fluffy_Pillow 931397.5/1100000: 85% mana combustion, hot_streak, pyretic_incantation(5)
4:14.781 arcane_torrent Fluffy_Pillow 926519.0/1100000: 84% mana combustion, heating_up, pyretic_incantation(5)
4:14.781 phoenixs_flames Fluffy_Pillow 959519.0/1100000: 87% mana combustion, heating_up, pyretic_incantation(5)
4:16.154 pyroblast Fluffy_Pillow 982173.5/1100000: 89% mana combustion, hot_streak, pyretic_incantation(5)
4:17.526 phoenixs_flames Fluffy_Pillow 977311.5/1100000: 89% mana combustion, heating_up, pyretic_incantation(5)
4:18.897 pyroblast Fluffy_Pillow 999933.0/1100000: 91% mana combustion, hot_streak, pyretic_incantation(5)
4:20.272 living_bomb Fluffy_Pillow 995120.5/1100000: 90% mana raid_movement, heating_up, pyretic_incantation(5)
4:21.644 Waiting 2.000 sec 1001258.5/1100000: 91% mana raid_movement, heating_up, pyretic_incantation(5)
4:23.644 fireball Fluffy_Pillow 1034258.5/1100000: 94% mana heating_up, pyretic_incantation(5)
4:25.514 fireball Fluffy_Pillow 1043113.5/1100000: 95% mana heating_up, pyretic_incantation(5)
4:27.385 pyroblast Fluffy_Pillow 1051985.0/1100000: 96% mana hot_streak, pyretic_incantation
4:28.759 Waiting 0.400 sec 1047156.0/1100000: 95% mana raid_movement, enhanced_pyrotechnics
4:29.159 fireball Fluffy_Pillow 1053756.0/1100000: 96% mana enhanced_pyrotechnics
4:31.030 fireball Fluffy_Pillow 1062627.5/1100000: 97% mana enhanced_pyrotechnics
4:32.901 fire_blast Fluffy_Pillow 1071499.0/1100000: 97% mana heating_up, pyretic_incantation
4:32.901 pyroblast Fluffy_Pillow 1060499.0/1100000: 96% mana hot_streak, pyretic_incantation(2)
4:34.276 fireball Fluffy_Pillow 1055686.5/1100000: 96% mana hot_streak, pyretic_incantation(4)
4:36.147 pyroblast Fluffy_Pillow 1064558.0/1100000: 97% mana hot_streak, pyretic_incantation(4)
4:37.520 living_bomb Fluffy_Pillow 1059712.5/1100000: 96% mana enhanced_pyrotechnics
4:38.891 fireball Fluffy_Pillow 1065834.0/1100000: 97% mana enhanced_pyrotechnics
4:40.763 rune_of_power Fluffy_Pillow 1074722.0/1100000: 98% mana enhanced_pyrotechnics
4:42.137 fire_blast Fluffy_Pillow 1097393.0/1100000: 100% mana heating_up, pyretic_incantation, rune_of_power
4:42.137 pyroblast Fluffy_Pillow 1086393.0/1100000: 99% mana hot_streak, pyretic_incantation(2), rune_of_power
4:43.509 phoenixs_flames Fluffy_Pillow 1081531.0/1100000: 98% mana heating_up, pyretic_incantation(3), rune_of_power
4:44.882 pyroblast Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(4), rune_of_power
4:46.254 fireball Fluffy_Pillow 1095138.0/1100000: 100% mana
4:48.125 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana
4:49.996 counterspell Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
4:49.996 fireball Fluffy_Pillow 1056066.0/1100000: 96% mana heating_up, pyretic_incantation
4:51.370 pyroblast Fluffy_Pillow 1078737.0/1100000: 98% mana raid_movement, hot_streak, pyretic_incantation(2)
4:52.743 living_bomb Fluffy_Pillow 1073891.5/1100000: 98% mana raid_movement, heating_up, pyretic_incantation(3)
4:54.115 fire_blast Fluffy_Pillow 1080029.5/1100000: 98% mana heating_up, pyretic_incantation(3)
4:54.115 pyroblast Fluffy_Pillow 1069029.5/1100000: 97% mana hot_streak, pyretic_incantation(4)
4:55.488 fireball Fluffy_Pillow 1064184.0/1100000: 97% mana
4:57.361 fireball Fluffy_Pillow 1073088.5/1100000: 98% mana
4:59.231 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana heating_up, pyretic_incantation
5:00.604 Waiting 0.600 sec 1100000.0/1100000: 100% mana raid_movement, enhanced_pyrotechnics
5:01.204 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics
5:03.076 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics
5:04.947 fire_blast Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
5:04.947 pyroblast Fluffy_Pillow 1067066.0/1100000: 97% mana hot_streak, pyretic_incantation(2)
5:06.320 fireball Fluffy_Pillow 1062220.5/1100000: 97% mana hot_streak, pyretic_incantation(4)
5:08.190 pyroblast Fluffy_Pillow 1071075.5/1100000: 97% mana hot_streak, pyretic_incantation(4)
5:09.564 living_bomb Fluffy_Pillow 1066246.5/1100000: 97% mana hot_streak, pyretic_incantation(5)
5:10.937 pyroblast Fluffy_Pillow 1072401.0/1100000: 97% mana hot_streak, pyretic_incantation(5)
5:12.310 fireball Fluffy_Pillow 1067555.5/1100000: 97% mana
5:14.183 fireball Fluffy_Pillow 1076460.0/1100000: 98% mana
5:16.003 fire_blast Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, heating_up, pyretic_incantation
5:16.003 pyroblast Fluffy_Pillow 1089000.0/1100000: 99% mana raid_movement, hot_streak, pyretic_incantation(2)
5:17.376 fireball Fluffy_Pillow 1084154.5/1100000: 99% mana heating_up, pyretic_incantation(3)
5:19.248 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation(3)
5:21.120 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics
5:22.994 fireball Fluffy_Pillow 1078115.5/1100000: 98% mana heating_up, pyretic_incantation
5:24.867 pyroblast Fluffy_Pillow 1078099.0/1100000: 98% mana hot_streak, pyretic_incantation(2)
5:26.238 fireball Fluffy_Pillow 1073220.5/1100000: 98% mana hot_streak, pyretic_incantation(4)
5:28.109 pyroblast Fluffy_Pillow 1078066.0/1100000: 98% mana hot_streak, pyretic_incantation(4)
5:29.482 fireball Fluffy_Pillow 1073220.5/1100000: 98% mana hot_streak, pyretic_incantation(5)
5:31.355 rune_of_power Fluffy_Pillow 1078099.0/1100000: 98% mana hot_streak, pyretic_incantation(5)
5:32.726 combustion Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(5)
5:32.726 pyroblast Fluffy_Pillow 990000.0/1100000: 90% mana raid_movement, combustion, hot_streak, pyretic_incantation(5)
5:34.100 fire_blast Fluffy_Pillow 985171.0/1100000: 90% mana combustion, heating_up, pyretic_incantation(5)
5:34.100 pyroblast Fluffy_Pillow 974171.0/1100000: 89% mana combustion, hot_streak, pyretic_incantation(5)
5:35.472 fire_blast Fluffy_Pillow 969309.0/1100000: 88% mana combustion, heating_up, pyretic_incantation(5)
5:35.472 flame_on Fluffy_Pillow 958309.0/1100000: 87% mana combustion, hot_streak, pyretic_incantation(5)
5:35.472 pyroblast Fluffy_Pillow 958309.0/1100000: 87% mana combustion, hot_streak, pyretic_incantation(5)
5:36.845 fire_blast Fluffy_Pillow 953463.5/1100000: 87% mana combustion, heating_up, pyretic_incantation(5)
5:36.845 pyroblast Fluffy_Pillow 942463.5/1100000: 86% mana combustion, hot_streak, pyretic_incantation(5)
5:38.216 counterspell Fluffy_Pillow 937585.0/1100000: 85% mana combustion, heating_up, pyretic_incantation(5)
5:38.216 fire_blast Fluffy_Pillow 915585.0/1100000: 83% mana combustion, heating_up, pyretic_incantation(5)
5:38.216 pyroblast Fluffy_Pillow 904585.0/1100000: 82% mana combustion, hot_streak, pyretic_incantation(5)
5:39.589 phoenixs_flames Fluffy_Pillow 899739.5/1100000: 82% mana combustion, heating_up, pyretic_incantation(5)
5:40.960 pyroblast Fluffy_Pillow 922361.0/1100000: 84% mana combustion, hot_streak, pyretic_incantation(5)
5:42.333 phoenixs_flames Fluffy_Pillow 917515.5/1100000: 83% mana combustion, heating_up, pyretic_incantation(5)
5:43.706 pyroblast Fluffy_Pillow 940170.0/1100000: 85% mana hot_streak, pyretic_incantation(5)
5:45.078 fireball Fluffy_Pillow 935308.0/1100000: 85% mana heating_up, pyretic_incantation(5)
5:46.950 fireball Fluffy_Pillow 944196.0/1100000: 86% mana heating_up, pyretic_incantation(5)
5:48.322 pyroblast Fluffy_Pillow 966834.0/1100000: 88% mana raid_movement, hot_streak, pyretic_incantation(5)
5:49.694 fireball Fluffy_Pillow 961972.0/1100000: 87% mana heating_up, pyretic_incantation(5)
5:51.566 fireball Fluffy_Pillow 970860.0/1100000: 88% mana heating_up, pyretic_incantation(5)
5:53.437 pyroblast Fluffy_Pillow 979731.5/1100000: 89% mana hot_streak, pyretic_incantation(5)
5:54.810 fireball Fluffy_Pillow 974886.0/1100000: 89% mana hot_streak, pyretic_incantation(5)
5:56.683 pyroblast Fluffy_Pillow 983790.5/1100000: 89% mana hot_streak, pyretic_incantation(5)
5:58.057 fire_blast Fluffy_Pillow 978961.5/1100000: 89% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
5:58.057 fireball Fluffy_Pillow 967961.5/1100000: 88% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
5:59.929 pyroblast Fluffy_Pillow 976849.5/1100000: 89% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
6:01.300 fireball Fluffy_Pillow 971971.0/1100000: 88% mana heating_up
6:03.171 fireball Fluffy_Pillow 980842.5/1100000: 89% mana heating_up
6:04.543 pyroblast Fluffy_Pillow 1003480.5/1100000: 91% mana raid_movement, hot_streak, pyretic_incantation
6:05.916 rune_of_power Fluffy_Pillow 998635.0/1100000: 91% mana heating_up, pyretic_incantation(2)
6:07.288 fire_blast Fluffy_Pillow 1021273.0/1100000: 93% mana heating_up, pyretic_incantation(2), rune_of_power
6:07.288 pyroblast Fluffy_Pillow 1010273.0/1100000: 92% mana hot_streak, pyretic_incantation(3), rune_of_power
6:08.659 phoenixs_flames Fluffy_Pillow 1005394.5/1100000: 91% mana heating_up, pyretic_incantation(4), rune_of_power
6:10.032 pyroblast Fluffy_Pillow 1028049.0/1100000: 93% mana hot_streak, pyretic_incantation(5), rune_of_power
6:11.406 fire_blast Fluffy_Pillow 1023220.0/1100000: 93% mana heating_up, pyretic_incantation(5), rune_of_power
6:11.406 pyroblast Fluffy_Pillow 1012220.0/1100000: 92% mana hot_streak, pyretic_incantation(5), rune_of_power
6:12.779 fireball Fluffy_Pillow 1007374.5/1100000: 92% mana rune_of_power
6:14.651 phoenixs_flames Fluffy_Pillow 1016262.5/1100000: 92% mana rune_of_power
6:16.025 counterspell Fluffy_Pillow 1038933.5/1100000: 94% mana enhanced_pyrotechnics, heating_up, rune_of_power
6:16.025 fireball Fluffy_Pillow 1016933.5/1100000: 92% mana enhanced_pyrotechnics, heating_up, rune_of_power
6:17.896 fireball Fluffy_Pillow 1025805.0/1100000: 93% mana enhanced_pyrotechnics, heating_up
6:19.767 pyroblast Fluffy_Pillow 1034676.5/1100000: 94% mana hot_streak, pyretic_incantation
6:21.140 Waiting 0.100 sec 1029831.0/1100000: 94% mana raid_movement, enhanced_pyrotechnics
6:21.240 fireball Fluffy_Pillow 1031481.0/1100000: 94% mana enhanced_pyrotechnics
6:23.112 rune_of_power Fluffy_Pillow 1040369.0/1100000: 95% mana enhanced_pyrotechnics
6:24.487 fire_blast Fluffy_Pillow 1063056.5/1100000: 97% mana enhanced_pyrotechnics(2), rune_of_power
6:24.487 flame_on Fluffy_Pillow 1052056.5/1100000: 96% mana enhanced_pyrotechnics(2), heating_up, pyretic_incantation, rune_of_power
6:24.487 fireball Fluffy_Pillow 1052056.5/1100000: 96% mana enhanced_pyrotechnics(2), heating_up, pyretic_incantation, rune_of_power
6:26.360 fire_blast Fluffy_Pillow 1060961.0/1100000: 96% mana enhanced_pyrotechnics(2), heating_up, pyretic_incantation, rune_of_power
6:26.360 pyroblast Fluffy_Pillow 1049961.0/1100000: 95% mana enhanced_pyrotechnics(2), hot_streak, pyretic_incantation(2), rune_of_power
6:27.733 pyroblast Fluffy_Pillow 1045115.5/1100000: 95% mana hot_streak, pyretic_incantation(4), rune_of_power
6:29.107 fire_blast Fluffy_Pillow 1040286.5/1100000: 95% mana heating_up, pyretic_incantation(5), rune_of_power
6:29.107 pyroblast Fluffy_Pillow 1029286.5/1100000: 94% mana hot_streak, pyretic_incantation(5), rune_of_power
6:30.480 fireball Fluffy_Pillow 1024441.0/1100000: 93% mana rune_of_power

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4872 4547 0
Agility 6579 6254 0
Stamina 30904 30904 19282
Intellect 31651 29945 21189 (1929)
Spirit 2 2 0
Health 1854240 1854240 0
Mana 1100000 1100000 0
Spell Power 31651 29945 0
Crit 41.19% 40.12% 11941
Haste 9.63% 9.63% 3130
Damage / Heal Versatility 2.06% 2.06% 824
ManaReg per Second 16500 16500 0
Mastery 10.83% 10.83% 2253
Armor 1621 1621 1621
Run Speed 7 0 404

Gear

Source Slot Average Item Level: 852.00
Local Head Mana-Etched Crown
ilevel: 835, stats: { 200 Armor, +1692 Sta, +1128 Int, +1237 Crit }
Local Neck Blackened Portalstone Necklace
ilevel: 850, stats: { +1094 Sta, +1206 Crit, +629 Haste }, gems: { +150 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Bonespeaker Mantle
ilevel: 840, stats: { 188 Armor, +886 Int, +1329 Sta, +674 Crit, +269 Mastery, +404 RunSpeed }
Local Chest Terrorweave Robe
ilevel: 850, stats: { 260 Armor, +1297 Int, +1945 Sta, +876 Crit, +428 Haste }
Local Waist Netherwhisper Cinch
ilevel: 840, stats: { 141 Armor, +886 Int, +1329 Sta, +674 Crit, +269 Vers }
Local Legs Bonespeaker Leggings
ilevel: 845, stats: { 224 Armor, +1238 Int, +1857 Sta, +915 Crit, +366 Mastery }, gems: { +150 Crit }
Local Feet Norgannon's Foresight
ilevel: 895, stats: { 210 Armor, +2219 Sta, +1479 Int, +662 Haste, +496 Mastery }
Local Wrists Bracers of Tirisgarde
ilevel: 840, stats: { 110 Armor, +997 Sta, +665 Int, +490 Crit, +217 Mastery }, gems: { +150 Crit }
Local Hands Bonespeaker Gloves
ilevel: 845, stats: { 160 Armor, +929 Int, +1393 Sta, +645 Crit, +315 Mastery }
Local Finger1 Utgarde Royal Signet
ilevel: 840, stats: { +997 Sta, +1213 Crit, +555 Vers }, enchant: { +200 Crit }
Local Finger2 Nightmare Loop
ilevel: 835, stats: { +952 Sta, +1191 Crit, +546 Haste }, gems: { +150 Crit }, enchant: { +200 Crit }
Local Trinket1 Twisting Wind
ilevel: 850, stats: { +1233 AgiInt }
Local Trinket2 Unstable Horrorslime
ilevel: 865, stats: { +986 Crit }
Local Back Stormsky Greatcloak
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +437 Crit, +283 Mastery }, gems: { +150 Crit }, enchant: { +200 Int }
Local Main Hand Felo'melorn
ilevel: 875, weapon: { 2079 - 3863, 2.6 }, stats: { +702 Int, +1052 Sta, +307 Haste, +307 Mastery, +8929 Int }, relics: { +40 ilevels, +43 ilevels, +42 ilevels }
Local Off Hand Heart of the Phoenix
ilevel: 875, stats: { +921 Int, +1381 Sta, +558 Haste, +247 Crit }

Talents

Level
15 Pyromaniac (Fire Mage) Conflagration (Fire Mage) Firestarter (Fire Mage)
30 Shimmer Cauterize Cold Snap
45 Mirror Image Rune of Power Incanter's Flow
60 Blast Wave (Fire Mage) Flame On (Fire Mage) Controlled Burn (Fire Mage)
75 Ice Floes Ring of Frost Ice Ward
90 Living Bomb (Fire Mage) Unstable Magic Flame Patch (Fire Mage)
100 Kindling (Fire Mage) Cinderstorm (Fire Mage) Meteor (Fire Mage)

Profile

mage="Mellarene"
origin="https://us.api.battle.net/wow/character/thrall/Mellarene/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/197/156956101-avatar.jpg"
level=110
race=blood_elf
role=spell
position=back
professions=alchemy=325/herbalism=768
talents=2122111
artifact=54:0:0:0:0:748:1:749:3:751:3:752:3:754:3:755:3:756:3:759:1:762:1:763:1:1340:1
spec=fire

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
actions+=/mirror_image,if=buff.combustion.down
actions+=/rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
actions+=/call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
actions+=/call_action_list,name=single_target

actions.active_talents=flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
actions.active_talents+=/blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
actions.active_talents+=/meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
actions.active_talents+=/cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
actions.active_talents+=/dragons_breath,if=equipped.132863
actions.active_talents+=/living_bomb,if=active_enemies>1&buff.combustion.down

actions.combustion_phase=rune_of_power,if=buff.combustion.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion
actions.combustion_phase+=/potion,name=deadly_grace
actions.combustion_phase+=/blood_fury
actions.combustion_phase+=/berserking
actions.combustion_phase+=/arcane_torrent
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.up
actions.combustion_phase+=/fire_blast,if=buff.heating_up.up
actions.combustion_phase+=/phoenixs_flames
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time
actions.combustion_phase+=/scorch,if=target.health.pct<=25&equipped.132454

actions.rop_phase=rune_of_power
actions.rop_phase+=/pyroblast,if=buff.hot_streak.up
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.rop_phase+=/fire_blast,if=!prev_off_gcd.fire_blast
actions.rop_phase+=/phoenixs_flames,if=!prev_gcd.phoenixs_flames
actions.rop_phase+=/scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase+=/fireball

actions.single_target=pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
actions.single_target+=/phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
actions.single_target+=/flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
actions.single_target+=/pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
actions.single_target+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
actions.single_target+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.single_target+=/call_action_list,name=active_talents
actions.single_target+=/fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
actions.single_target+=/scorch,if=target.health.pct<=25&equipped.132454
actions.single_target+=/fireball

head=manaetched_crown,id=127450,bonus_id=615/656
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/1808/1472,gems=150crit,enchant=mark_of_the_hidden_satyr
shoulders=bonespeaker_mantle,id=134221,bonus_id=3397/42/1502/3336
back=stormsky_greatcloak,id=134202,bonus_id=3474/1808/1507/1674,gems=150crit,enchant=200int
chest=terrorweave_robe,id=121327,bonus_id=3473/1512/3336
wrists=bracers_of_tirisgarde,id=139754,bonus_id=3386/3384,gems=150crit
hands=bonespeaker_gloves,id=134217,bonus_id=3474/1507/1674
waist=netherwhisper_cinch,id=134391,bonus_id=1727/1502/1813
legs=bonespeaker_leggings,id=134218,bonus_id=1727/1808/1507/3336,gems=150crit
feet=norgannons_foresight,id=132455,bonus_id=1811
finger1=utgarde_royal_signet,id=133637,bonus_id=1727/1492/1813,enchant=200crit
finger2=nightmare_loop,id=121288,bonus_id=3397/1808/1497/3336,gems=150crit,enchant=200crit
trinket1=twisting_wind,id=139323,bonus_id=1807/1472
trinket2=unstable_horrorslime,id=138224,bonus_id=1805/1487
main_hand=felomelorn,id=128820,bonus_id=730,gem_id=141265/141272/141261/0,relic_id=3473:1502:1674/3474:1512:3336/3473:1507:3336/0
off_hand=heart_of_the_phoenix,id=133959

# Gear Summary
# gear_ilvl=851.56
# gear_stamina=19282
# gear_intellect=21189
# gear_crit_rating=11941
# gear_haste_rating=3130
# gear_mastery_rating=2253
# gear_versatility_rating=824
# gear_speed_rating=404
# gear_armor=1621

Zipi

Zipi : 411697 dps, 246418 dps to main target

  • Race: Tauren
  • Class: Paladin
  • Spec: Retribution
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
411697.3 411697.3 424.9 / 0.103% 81725.5 / 19.9% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 11.68% 56.1 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Zipi/advanced
Talents
  • 15: Execution Sentence (Retribution Paladin)
  • 30: Zeal (Retribution Paladin)
  • 45: Blinding Light
  • 60: Virtue's Blade (Retribution Paladin)
  • 75: Eye for an Eye (Retribution Paladin)
  • 90: Cavalier (Retribution Paladin)
  • 100: Holy Wrath (Retribution Paladin)
  • Talent Calculator
Artifact
Professions
  • mining: 706
  • herbalism: 633
Scale Factors for Zipi Damage Per Second
Haste Str Crit Vers Mastery
Scale Factors 13.11 11.81 10.63 10.19 5.98
Normalized 1.11 1.00 0.90 0.86 0.51
Scale Deltas 1138 1138 1138 1138 1138
Error 0.55 0.53 0.53 0.53 0.53
Gear Ranking
Optimizers
Ranking
  • Haste > Str > Crit ~= Vers > Mastery
Pawn string ( Pawn: v1: "Zipi": Strength=11.81, CritRating=10.63, HasteRating=13.11, MasteryRating=5.98, Versatility=10.19 )

Scale Factors for other metrics

Scale Factors for Zipi Damage Per Second
Haste Str Crit Vers Mastery
Scale Factors 13.11 11.81 10.63 10.19 5.98
Normalized 1.11 1.00 0.90 0.86 0.51
Scale Deltas 1138 1138 1138 1138 1138
Error 0.55 0.53 0.53 0.53 0.53
Gear Ranking
Optimizers
Ranking
  • Haste > Str > Crit ~= Vers > Mastery
Pawn string ( Pawn: v1: "Zipi": Strength=11.81, CritRating=10.63, HasteRating=13.11, MasteryRating=5.98, Versatility=10.19 )
Scale Factors for Zipi Priority Target Damage Per Second
Str Crit Vers Mastery Haste
Scale Factors 6.84 6.68 6.05 4.47 3.69
Normalized 1.00 0.98 0.89 0.65 0.54
Scale Deltas 1138 1138 1138 1138 1138
Error 0.16 0.16 0.16 0.16 0.15
Gear Ranking
Optimizers
Ranking
  • Str ~= Crit > Vers > Mastery > Haste
Pawn string ( Pawn: v1: "Zipi": Strength=6.84, CritRating=6.68, HasteRating=3.69, MasteryRating=4.47, Versatility=6.05 )
Scale Factors for Zipi Damage Per Second (Effective)
Haste Str Crit Vers Mastery
Scale Factors 13.11 11.81 10.63 10.19 5.98
Normalized 1.11 1.00 0.90 0.86 0.51
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Haste > Str > Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Zipi": Strength=11.81, CritRating=10.63, HasteRating=13.11, MasteryRating=5.98, Versatility=10.19 )
Scale Factors for Zipi Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for ZipiTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Zipi 411697
Blade of Justice 34891 8.5% 50.8 7.90sec 275135 259667 Direct 50.8 185692 571653 275139 23.2%  

Stats details: blade_of_justice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.79 50.79 0.00 0.00 1.0596 0.0000 13974263.57 20543491.13 31.98 259667.45 259667.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.02 76.83% 185691.88 160289 247034 185700.73 172178 199500 7245719 10651893 31.98
crit 11.77 23.17% 571653.50 493689 760866 571765.47 498054 749469 6728545 9891598 31.98
 
 

Action details: blade_of_justice

Static Values
  • id:184575
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
Spelldata
  • id:184575
  • name:Blade of Justice
  • school:physical
  • tooltip:
  • description:Strikes an enemy with the Blade of Justice, dealing ${$sw2*$<mult>} Physical damage. |cFFFFFFFFGenerates {$s3=2} Holy Power.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.50
 
Greater Blessing of Might (blessing_of_might_proc) 31155 7.6% 362.9 2.00sec 34184 0 Direct 267.8 46329 0 46329 0.0%  

Stats details: blessing_of_might_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 362.94 267.79 0.00 0.00 0.0000 0.0000 12406496.01 12406496.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 267.79 100.00% 46329.11 6435 238732 46301.75 38985 54481 12406496 12406496 0.00
 
 

Action details: blessing_of_might_proc

Static Values
  • id:205729
  • school:holy
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205729
  • name:Greater Blessing of Might
  • school:holy
  • tooltip:
  • description:{$@spelldesc203528=Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.}
 
Divine Storm 98183 23.6% 39.3 7.44sec 986029 922134 Direct 235.9 132412 270139 164337 23.2%  

Stats details: divine_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.32 235.90 0.00 0.00 1.0693 0.0000 38767433.88 38767433.88 0.00 922133.96 922133.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.22 76.82% 132412.14 102642 216783 132414.71 127202 137091 23995351 23995351 0.00
crit 54.68 23.18% 270139.35 209390 442237 270135.89 242032 301446 14772083 14772083 0.00
 
 

Action details: divine_storm

Static Values
  • id:53385
  • school:holy
  • resource:holy_power
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:53385
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:Unleashes a whirl of divine energy, dealing $224239sw1 Holy damage to all nearby enemies.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Execution Sentence 23777 5.8% 16.8 24.71sec 569821 521444 Periodic 16.5 467249 953066 580207 23.2% 20.8%

Stats details: execution_sentence

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.82 0.00 16.52 16.52 1.0928 5.0427 9585182.31 9585182.31 0.00 94258.85 521443.93
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.7 76.75% 467249.10 314075 655204 467334.90 427122 526320 5924499 5924499 0.00
crit 3.8 23.25% 953066.32 640713 1336616 936118.10 0 1336616 3660683 3660683 0.00
 
 

Action details: execution_sentence

Static Values
  • id:213757
  • school:holy
  • resource:holy_power
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
Spelldata
  • id:213757
  • name:Execution Sentence
  • school:holy
  • tooltip:Taking $s2 Holy damage when this expires.
  • description:A hammer slowly falls from the sky, dealing $s2 Holy damage after {$d=7 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:11.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:7.00
  • base_tick_time:7.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Judgment 24307 5.9% 44.3 9.06sec 219814 204494 Direct 44.3 177086 361741 219853 23.2%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.28 44.27 0.00 0.00 1.0749 0.0000 9732291.89 9732291.89 0.00 204494.28 204494.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.01 76.84% 177085.98 153859 238182 177106.43 165475 189063 6023350 6023350 0.00
crit 10.25 23.16% 361740.83 313872 485892 361711.24 317035 485892 3708942 3708942 0.00
 
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Judges the target{$?s218178=false}[ and up to ${{$231661s1=1}+{$218178s2=2}} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing {$s1=0} Holy damage{$?s76672=false}|a231663[, and causing them to take {$197277s1=0}% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by {$231657s1=2} sec, or ${{$231657s1=2}*2} sec on a critical strike][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Judgment (_aoe) 12229 2.9% 44.3 9.06sec 109068 0 Direct 22.9 169912 346669 210929 23.2%  

Stats details: judgment_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.27 22.89 0.00 0.00 0.0000 0.0000 4828078.08 4828078.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.58 76.80% 169912.36 142968 221323 169894.59 147541 189512 2986753 2986753 0.00
crit 5.31 23.20% 346669.45 291655 451499 345584.25 0 451499 1841325 1841325 0.00
 
 

Action details: judgment_aoe

Static Values
  • id:228288
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228288
  • name:Judgment
  • school:holy
  • tooltip:
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${{$231661s1=1}+{$218178s2=2}} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing {$s1=0} Holy damage{$?s76672=false}|a231663[, and causing them to take {$197277s1=0}% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by {$231657s1=2} sec, or ${{$231657s1=2}*2} sec on a critical strike][].}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
melee 11828 2.9% 114.8 3.48sec 41334 16553 Direct 114.8 33333 67973 41335 23.1%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.83 114.83 0.00 0.00 2.4971 0.0000 4746522.25 6977837.31 31.98 16553.05 16553.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.31 76.90% 33333.25 27977 44254 33340.02 31553 34756 2943642 4327433 31.98
crit 26.52 23.10% 67972.88 57074 90278 67988.20 59443 79075 1802880 2650404 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Potion of the Old War 15049 3.6% 29.0 5.42sec 204955 0 Direct 29.0 165255 337177 204958 23.1%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.99 28.99 0.00 0.00 0.0000 0.0000 5941988.38 8735285.75 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.30 76.91% 165255.12 117301 178885 165271.44 155718 175874 3684707 5416868 31.98
crit 6.69 23.09% 337177.16 272796 364925 336902.58 0 364925 2257281 3318417 31.95
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rend Flesh 2827 0.7% 21.7 18.32sec 52347 0 Periodic 83.2 10988 22411 13629 23.1% 41.1%

Stats details: rend_flesh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.67 0.00 83.25 83.25 0.0000 1.9787 1134600.40 1134600.40 0.00 6888.22 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.0 76.88% 10987.89 29 14918 10998.63 9709 12597 703174 703174 0.00
crit 19.3 23.12% 22411.23 90 30433 22439.16 17975 28058 431427 431427 0.00
 
 

Action details: rend_flesh

Static Values
  • id:221770
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221770
  • name:Rend Flesh
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:{$@spelldesc221767=Your critical autoattacks have a chance to cause your target to bleed for $221770o1 Physical damage over {$221770d=8 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:9638.13
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Templar's Verdict 31731 7.8% 36.6 11.02sec 351978 324077 Direct 36.6 284068 579344 351973 23.0%  

Stats details: templars_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.57 36.57 0.00 0.00 1.0861 0.0000 12872328.62 12872328.62 0.00 324076.75 324076.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.16 77.00% 284068.02 255345 390085 283656.33 263435 304538 7999399 7999399 0.00
crit 8.41 23.00% 579344.49 520904 795774 578100.89 0 742446 4872930 4872930 0.00
 
 

Action details: templars_verdict

Static Values
  • id:85256
  • school:holy
  • resource:holy_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:85256
  • name:Templar's Verdict
  • school:holy
  • tooltip:
  • description:A powerful weapon strike that deals ${$224266sw1*$<mult>} Holy damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Wake of Ashes 50342 12.2% 13.3 31.30sec 1497812 1332276 Direct 53.5 208389 424930 258561 23.2%  
Periodic 154.4 32023 65324 39724 23.1% 38.5%

Stats details: wake_of_ashes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.33 53.52 154.36 154.36 1.1243 1.0000 19969484.08 19969484.08 0.00 117917.72 1332275.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.12 76.83% 208389.33 176374 283026 208339.32 193627 226426 8568671 8568671 0.00
crit 12.40 23.17% 424930.25 359803 577373 424889.55 373905 525172 5268931 5268931 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 118.7 76.87% 32023.22 29848 47896 32018.81 31544 32890 3800058 3800058 0.00
crit 35.7 23.13% 65323.64 60889 97709 65316.00 63641 68616 2331823 2331823 0.00
 
 

Action details: wake_of_ashes

Static Values
  • id:205273
  • school:holyfire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power>=0&time<2
Spelldata
  • id:205273
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:Movement speed reduced by {$s2=50}%. $?$w3!=0[Suffering {$s3=0} Radiant damage every $t3 sec][]
  • description:Lash out with the |cFFFFCC99Ashbringer|r, dealing $sw1 Radiant damage$?a179546[, and an additional $o3 Radiant damage over {$d=6 seconds},][] to all enemies within $a1 yd in front of you, and reducing movement speed by {$s2=50}% for {$d=6 seconds}. Demon and Undead enemies are stunned for {$205290d=6 seconds} if struck by the Wake of Ashes.$?a179546[ |cFFFFFFFFGenerates {$218001s1=5} Holy Power.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:6.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.100000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Zeal 75380 18.3% 118.1 3.38sec 254249 235588 Direct 289.6 72582 148168 103658 41.1%  

Stats details: zeal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.08 289.63 0.00 0.00 1.0792 0.0000 30022656.83 44136149.37 31.98 235588.23 235588.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 170.55 58.89% 72582.03 21450 153045 72494.06 61707 82914 12379137 18198504 31.98
crit 119.08 41.11% 148167.88 43757 312211 147994.31 123057 170241 17643520 25937646 31.98
 
 

Action details: zeal

Static Values
  • id:217020
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2&holy_power<=4
Spelldata
  • id:217020
  • name:Zeal
  • school:physical
  • tooltip:Chains to an additonal nearby target per stack.
  • description:Strike the target for $sw2 Physical damage. Maximum {$s5=2} charges. Grants Zeal, causing Zeal attacks to chain to an additional nearby target per stack. Maximum {$u=3} stacks. Each jump deals {$s6=40}% less damage. |cFFFFFFFFGenerates {$s3=1} Holy Power.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.20
 
Simple Action Stats Execute Interval
Zipi
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
 
Crusade 3.7 124.98sec

Stats details: crusade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 3.65 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crusade

Static Values
  • id:231895
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing_Target
  • harmful:false
  • if_expr:holy_power>=5
Spelldata
  • id:231895
  • name:Crusade
  • school:holy
  • tooltip:Damage and haste increased by ${{$s1=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
 
Greater Blessing of Might 1.0 0.00sec

Stats details: greater_blessing_of_might

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: greater_blessing_of_might

Static Values
  • id:203528
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing_Target
  • harmful:false
  • if_expr:
Spelldata
  • id:203528
  • name:Greater Blessing of Might
  • school:holy
  • tooltip:Attacks have a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy.
  • description:Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rebuke 13.2 30.94sec

Stats details: rebuke

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.23 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rebuke

Static Values
  • id:96231
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96231
  • name:Rebuke
  • school:physical
  • tooltip:
  • description:Interrupts spellcasting and prevents any spell in that school from being cast for {$d=4 seconds}.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Shield of Vengeance 4.5 100.23sec

Stats details: shield_of_vengeance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 4.50 4.50 0.00 0.00 0.0000 0.0000 0.00 3136344.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.48 77.41% 0.00 0 0 0.00 0 0 0 1965702 99.87
crit 1.02 22.59% 0.00 0 0 0.00 0 0 0 1170642 68.22
 
 

Action details: shield_of_vengeance

Static Values
  • id:184662
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:100.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing_Target
  • harmful:false
  • if_expr:
Spelldata
  • id:184662
  • name:Shield of Vengeance
  • school:holy
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
 
shield_of_vengeance_proc 4.5 99.95sec

Stats details: shield_of_vengeance_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.50 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shield_of_vengeance_proc

Static Values
  • id:184689
  • school:holy
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 31.70% 0.0(0.0) 1.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Chaotic Energy 1.0 113.8 0.0sec 3.5sec 99.38% 99.38% 94.8(94.8) 0.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_chaotic_energy
  • max_stacks:20
  • duration:23.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:66.50

Stack Uptimes

  • chaotic_energy_1:0.49%
  • chaotic_energy_2:0.49%
  • chaotic_energy_3:0.45%
  • chaotic_energy_4:0.42%
  • chaotic_energy_5:0.39%
  • chaotic_energy_6:1.01%
  • chaotic_energy_7:0.37%
  • chaotic_energy_8:0.37%
  • chaotic_energy_9:0.37%
  • chaotic_energy_10:1.42%
  • chaotic_energy_11:0.37%
  • chaotic_energy_12:0.99%
  • chaotic_energy_13:0.37%
  • chaotic_energy_14:0.56%
  • chaotic_energy_15:0.56%
  • chaotic_energy_16:0.56%
  • chaotic_energy_17:0.56%
  • chaotic_energy_18:0.73%
  • chaotic_energy_19:1.06%
  • chaotic_energy_20:87.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214831
  • name:Chaotic Energy
  • tooltip:Strength or Agility increased by $w3.
  • description:{$@spelldesc214829=Your melee autoattacks grant you Chaotic Energy, increasing your Strength or Agility by {$214831s3=50}, stacking up to {$214831u=20} times. If you do not autoattack an enemy for 4 sec, this effect will decrease by 1 stack every sec.}
  • max_stacks:20
  • duration:23.00
  • cooldown:0.00
  • default_chance:101.00%
Crusade 3.7 31.0 125.0sec 10.6sec 26.62% 100.00% 16.6(42.7) 3.5

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_crusade
  • max_stacks:15
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • crusade_1:0.20%
  • crusade_4:3.30%
  • crusade_7:2.38%
  • crusade_10:2.96%
  • crusade_13:4.78%
  • crusade_15:13.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:231895
  • name:Crusade
  • tooltip:Damage and haste increased by ${{$s1=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
  • max_stacks:15
  • duration:20.00
  • cooldown:20.00
  • default_chance:100.00%
Potion of the Old War 2.0 0.0 130.5sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.53% 14.53% 2.0(2.0) 0.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Shield of Vengeance 4.5 0.0 100.2sec 100.2sec 16.71% 16.71% 0.0(0.0) 4.4

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • duration:15.00
  • cooldown:100.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • shield_of_vengeance_1:16.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:101.00%
Zeal 1.0 117.1 0.0sec 3.4sec 99.48% 99.14% 115.1(115.1) 0.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_zeal
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • zeal_1:0.83%
  • zeal_2:0.19%
  • zeal_3:98.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:217020
  • name:Zeal
  • tooltip:Chains to an additonal nearby target per stack.
  • description:Strike the target for $sw2 Physical damage. Maximum {$s5=2} charges. Grants Zeal, causing Zeal attacks to chain to an additional nearby target per stack. Maximum {$u=3} stacks. Each jump deals {$s6=40}% less damage. |cFFFFFFFFGenerates {$s3=1} Holy Power.
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Greater Blessing of Might (blessing_of_might)

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_blessing_of_might
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blessing_of_might_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203528
  • name:Greater Blessing of Might
  • tooltip:Attacks have a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy.
  • description:Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Zipi
divine_storm Holy Power 39.3 117.9 3.0 3.0 328677.4
execution_sentence Holy Power 16.8 50.5 3.0 3.0 189939.6
templars_verdict Holy Power 36.6 109.7 3.0 3.0 117325.6
Resource Gains Type Count Total Average Overflow
wake_of_ashes Holy Power 13.33 60.76 (21.67%) 4.56 5.90 8.85%
zeal Holy Power 118.08 118.08 (42.11%) 1.00 0.00 0.00%
blade_of_justice Holy Power 50.79 101.58 (36.22%) 2.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Holy Power 0.70 0.69
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Holy Power 2.35 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Zipi Fight Length
Count 9999
Mean 400.62
Minimum 307.54
Maximum 499.01
Spread ( max - min ) 191.47
Range [ ( max - min ) / 2 * 100% ] 23.90%
DPS
Sample Data Zipi Damage Per Second
Count 9999
Mean 411697.27
Minimum 355577.68
Maximum 488339.12
Spread ( max - min ) 132761.44
Range [ ( max - min ) / 2 * 100% ] 16.12%
Standard Deviation 21680.3956
5th Percentile 379089.42
95th Percentile 450867.80
( 95th Percentile - 5th Percentile ) 71778.38
Mean Distribution
Standard Deviation 216.8148
95.00% Confidence Intervall ( 411272.32 - 412122.22 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 106
0.1% Error 10653
0.1 Scale Factor Error with Delta=300 4012527
0.05 Scale Factor Error with Delta=300 16050111
0.01 Scale Factor Error with Delta=300 401252797
Priority Target DPS
Sample Data Zipi Priority Target Damage Per Second
Count 9999
Mean 246417.88
Minimum 224009.27
Maximum 270554.84
Spread ( max - min ) 46545.57
Range [ ( max - min ) / 2 * 100% ] 9.44%
Standard Deviation 6492.6982
5th Percentile 235856.90
95th Percentile 257177.00
( 95th Percentile - 5th Percentile ) 21320.10
Mean Distribution
Standard Deviation 64.9302
95.00% Confidence Intervall ( 246290.62 - 246545.14 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2666
0.1 Scale Factor Error with Delta=300 359860
0.05 Scale Factor Error with Delta=300 1439441
0.01 Scale Factor Error with Delta=300 35986043
DPS(e)
Sample Data Zipi Damage Per Second (Effective)
Count 9999
Mean 411697.27
Minimum 355577.68
Maximum 488339.12
Spread ( max - min ) 132761.44
Range [ ( max - min ) / 2 * 100% ] 16.12%
Damage
Sample Data Zipi Damage
Count 9999
Mean 163981326.30
Minimum 138710736.03
Maximum 196897600.16
Spread ( max - min ) 58186864.13
Range [ ( max - min ) / 2 * 100% ] 17.74%
DTPS
Sample Data Zipi Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Zipi Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Zipi Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Zipi Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Zipi Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Zipi Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ZipiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Zipi Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_countless_armies
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 greater_blessing_of_might
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
6 32.81 auto_attack
7 13.23 rebuke
8 1.00 potion,name=old_war,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up|target.time_to_die<=40)
0.00 holy_wrath
0.00 avenging_wrath
9 4.50 shield_of_vengeance
A 3.65 crusade,if=holy_power>=5
B 1.00 wake_of_ashes,if=holy_power>=0&time<2
C 16.82 execution_sentence,if=spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent,if=holy_power<5
D 0.00 call_action_list,name=VB,if=talent.virtues_blade.enabled
E 0.00 call_action_list,name=DH,if=talent.divine_hammer.enabled
actions.VB
# count action,conditions
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
F 10.08 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
0.00 justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
G 9.36 templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
H 8.11 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
I 0.93 templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
J 12.33 wake_of_ashes,if=holy_power=0|holy_power=1&cooldown.blade_of_justice.remains>gcd|holy_power=2&(cooldown.zeal.charges_fractional<=0.34|cooldown.crusader_strike.charges_fractional<=0.34)
K 19.85 zeal,if=charges=2&holy_power<=4
0.00 crusader_strike,if=charges=2&holy_power<=4
L 50.83 blade_of_justice,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
M 44.28 judgment,if=holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&cooldown.blade_of_justice.remains>gcd)|(talent.greater_judgment.enabled&target.health.pct>50)
0.00 consecration
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
N 11.70 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
0.00 templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
O 17.61 templars_verdict,if=debuff.judgment.up&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
P 98.53 zeal,if=holy_power<=4
0.00 crusader_strike,if=holy_power<=4
Q 9.43 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
R 8.67 templars_verdict,if=debuff.judgment.up&holy_power>=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)

Sample Sequence

0123569BAC7KLMGKPOPLOMPPC6LPMRPLPOMLQ6KPMPLF6PHJFKLMFKPNPL7CMP6PLGPMQ6KLPNPM6PHJFLKCPMPOL67POPM6PLFPQPML6HJFKP9CLMPOP6PLM6F7PPNLPMH6PPHJA8CLMOKPRPLR6PMPLNPMPQLP7QMPL6QPJCMLOKPRPLM6PNPLPMFPQPLH67JCPMPOLPO9M6KL7NKPPMNLPHJC6PMPO7LPOM6KLN6KPQPLMPH7PJACL6PMGPRPLQM67PLPN6MPLNPMPLFPCJM6GLK7G6KMPNLP9N6PMPLFPCPJMGL6OKPRPLCMP7P6LOPMPRPLCJM6GKLGKPMOPLCP6PMRLP7RPJAMGLKC6PPOLMPOPL

Sample Sequence Table

time name target resources buffs
Pre flask Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre food Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre augmentation Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre greater_blessing_of_might Healing_Target 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre potion Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power potion_of_the_old_war
0:00.000 shield_of_vengeance Healing_Target 220000.0/220000: 100% mana | 0.0/5: 0% holy_power potion_of_the_old_war
0:00.000 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power shield_of_vengeance, potion_of_the_old_war
0:01.157 crusade Healing_Target 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, shield_of_vengeance, potion_of_the_old_war
0:01.157 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade, shield_of_vengeance, potion_of_the_old_war
0:02.054 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(4), shield_of_vengeance, potion_of_the_old_war
0:02.054 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(4), shield_of_vengeance, potion_of_the_old_war
0:02.867 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(4), zeal, shield_of_vengeance, chaotic_energy, potion_of_the_old_war
0:03.681 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(4), zeal, shield_of_vengeance, chaotic_energy, potion_of_the_old_war
0:04.498 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(4), zeal, shield_of_vengeance, chaotic_energy(2), potion_of_the_old_war
0:05.314 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(7), zeal, shield_of_vengeance, chaotic_energy(2), potion_of_the_old_war
0:06.071 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(7), zeal(2), shield_of_vengeance, chaotic_energy(2), potion_of_the_old_war
0:06.825 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(7), zeal(3), shield_of_vengeance, chaotic_energy(3), potion_of_the_old_war
0:07.579 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(10), zeal(3), shield_of_vengeance, chaotic_energy(3), potion_of_the_old_war
0:08.334 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(10), zeal(3), shield_of_vengeance, chaotic_energy(4), potion_of_the_old_war
0:09.296 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(10), zeal(3), shield_of_vengeance, chaotic_energy(4), potion_of_the_old_war
0:10.049 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(5), potion_of_the_old_war
0:10.921 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(5), potion_of_the_old_war
0:11.676 Waiting 0.100 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:11.776 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:12.750 Waiting 0.100 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, raid_movement, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:12.850 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, raid_movement, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:13.817 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:13.817 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:14.572 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:15.327 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(7), potion_of_the_old_war
0:16.082 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(7), potion_of_the_old_war
0:16.838 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(8), potion_of_the_old_war
0:17.592 Waiting 0.300 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(8), potion_of_the_old_war
0:17.892 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(8), potion_of_the_old_war
0:18.814 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(9), potion_of_the_old_war
0:19.571 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(9), potion_of_the_old_war
0:20.326 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(10), potion_of_the_old_war
0:21.082 Waiting 1.000 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(10), potion_of_the_old_war
0:22.082 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(10), potion_of_the_old_war
0:23.056 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(10)
0:23.807 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(10)
0:23.807 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(10)
0:24.559 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(10)
0:25.313 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(11)
0:26.066 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(11)
0:26.819 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(12)
0:27.574 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(12)
0:28.327 Waiting 0.900 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(12)
0:29.227 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(12)
0:29.227 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(12)
0:29.983 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(12)
0:30.735 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(13)
0:31.489 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, zeal(3), chaotic_energy(13)
0:32.418 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3), chaotic_energy(14)
0:33.347 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, zeal(3), chaotic_energy(14)
0:34.278 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, zeal(3), chaotic_energy(14)
0:35.206 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, zeal(3), chaotic_energy(15)
0:36.134 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3), chaotic_energy(15)
0:37.061 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, zeal(3), chaotic_energy(16)
0:37.990 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, zeal(3), chaotic_energy(16)
0:38.919 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, zeal(3), chaotic_energy(17)
0:39.845 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3), chaotic_energy(17)
0:40.772 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, zeal(3), chaotic_energy(17)
0:40.772 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, zeal(3), chaotic_energy(17)
0:41.911 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(18)
0:43.116 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(18)
0:44.322 Waiting 0.900 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(19)
0:45.222 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(19)
0:45.222 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(19)
0:46.428 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(19)
0:47.632 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(19)
0:48.838 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
0:50.043 Waiting 1.300 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20)
0:51.343 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20)
0:52.727 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20)
0:53.932 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
0:53.932 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
0:55.138 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
0:56.344 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
0:57.548 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
0:58.754 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
0:59.959 Waiting 1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:00.959 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:02.341 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:02.341 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:03.545 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:04.750 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
1:05.953 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
1:07.158 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:08.366 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:09.570 Waiting 0.500 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
1:10.070 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
1:11.276 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:12.480 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:13.686 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:14.892 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:16.095 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:17.302 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:17.302 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:17.302 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:18.506 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:19.711 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
1:20.916 Waiting 1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:21.916 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:23.296 Waiting 0.300 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:23.596 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:23.596 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:24.801 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:26.007 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
1:27.214 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:28.418 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:29.622 Waiting 0.200 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
1:29.822 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
1:31.198 Waiting 0.300 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
1:31.498 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
1:32.911 Waiting 0.100 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:33.011 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:34.415 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:34.415 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:35.620 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
1:36.827 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
1:38.031 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:39.236 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:40.000 shield_of_vengeance Healing_Target 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
1:40.441 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
1:41.647 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
1:42.853 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
1:44.058 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
1:45.263 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
1:46.467 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
1:47.673 Waiting 1.500 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
1:49.173 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
1:49.173 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
1:50.378 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), shield_of_vengeance, chaotic_energy(20)
1:51.583 Waiting 0.700 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement, zeal(3), shield_of_vengeance, chaotic_energy(20)
1:52.283 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement, zeal(3), shield_of_vengeance, chaotic_energy(20)
1:53.671 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
1:53.671 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
1:54.876 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
1:54.876 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
1:56.083 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:57.288 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:58.492 Waiting 0.100 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
1:58.592 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
1:59.992 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
2:01.198 Waiting 0.700 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
2:01.898 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
2:03.282 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
2:04.488 Waiting 0.700 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
2:05.188 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
2:05.188 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
2:06.392 Waiting 0.300 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
2:06.692 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
2:08.067 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
2:09.271 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
2:10.476 crusade Healing_Target 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
2:10.476 potion Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), chaotic_energy(20)
2:10.476 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), chaotic_energy(20), potion_of_the_old_war
2:11.640 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:12.697 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:13.755 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:14.812 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(7), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:15.782 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:16.753 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:17.724 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(10), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:18.619 Waiting 0.200 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:18.819 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:19.912 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(10), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:20.807 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:20.807 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:21.635 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:22.463 Waiting 0.800 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:23.263 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:24.329 Waiting 0.700 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:25.029 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:26.078 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:26.908 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:27.699 Waiting 0.300 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:27.999 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:29.032 Waiting 0.100 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:29.132 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:30.078 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:30.869 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:31.819 Waiting 0.200 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:32.019 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:32.976 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:32.976 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:33.766 Waiting 0.600 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:34.366 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:35.335 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:36.125 Waiting 0.200 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, crusade(15), zeal(3), chaotic_energy(20)
2:36.325 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, crusade(15), zeal(3), chaotic_energy(20)
2:37.333 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20)
2:37.333 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20)
2:38.123 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20)
2:38.913 Waiting 0.200 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
2:39.113 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
2:40.063 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), zeal(3), chaotic_energy(20)
2:40.855 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
2:42.060 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
2:43.267 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
2:44.473 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
2:45.679 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
2:46.883 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
2:48.088 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
2:49.294 Waiting 1.000 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
2:50.294 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
2:51.678 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20)
2:52.884 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
2:52.884 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
2:54.090 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
2:55.296 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
2:56.500 Waiting 2.200 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
2:58.700 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:00.085 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:01.290 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
3:02.493 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
3:03.698 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:04.902 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:06.108 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
3:07.313 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:08.520 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:09.726 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
3:09.726 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
3:09.726 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
3:10.931 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
3:12.136 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:13.340 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:14.545 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:15.751 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:16.957 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:18.161 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:19.366 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:20.570 shield_of_vengeance Healing_Target 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:20.570 Waiting 2.200 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), shield_of_vengeance, chaotic_energy(20)
3:22.770 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), shield_of_vengeance, chaotic_energy(20)
3:24.157 Waiting 1.000 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), shield_of_vengeance, chaotic_energy(20)
3:25.157 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
3:25.157 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
3:26.364 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
3:27.569 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
3:27.569 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
3:28.775 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
3:29.982 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
3:31.187 Waiting 1.000 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
3:32.187 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
3:33.585 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
3:34.790 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
3:35.996 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:37.201 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:38.405 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:39.611 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:40.931 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:42.136 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:42.136 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:43.341 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:44.546 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:45.752 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:46.957 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:46.957 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:48.164 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:49.368 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:50.574 Waiting 2.200 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:52.774 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:54.158 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:54.158 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:55.364 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:56.572 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:57.778 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:57.778 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:58.985 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
4:00.191 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
4:01.396 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
4:02.602 Waiting 1.000 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
4:03.602 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
4:04.981 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
4:06.187 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
4:07.391 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
4:08.599 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
4:08.599 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
4:09.804 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
4:11.009 crusade Healing_Target 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
4:11.009 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), chaotic_energy(20)
4:12.174 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, crusade(4), zeal(3), chaotic_energy(20)
4:13.245 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), zeal(3), chaotic_energy(20)
4:13.245 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), zeal(3), chaotic_energy(20)
4:14.302 Waiting 0.100 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(4), zeal(3), chaotic_energy(20)
4:14.402 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(4), zeal(3), chaotic_energy(20)
4:15.651 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(4), zeal(3), chaotic_energy(20)
4:16.710 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), zeal(3), chaotic_energy(20)
4:17.682 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), zeal(3), chaotic_energy(20)
4:18.654 Waiting 0.500 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(10), zeal(3), chaotic_energy(20)
4:19.154 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(10), zeal(3), chaotic_energy(20)
4:20.296 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, crusade(10), zeal(3), chaotic_energy(20)
4:21.190 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, crusade(10), zeal(3), chaotic_energy(20)
4:22.082 Waiting 0.700 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power raid_movement, crusade(13), zeal(3), chaotic_energy(20)
4:22.782 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power raid_movement, crusade(13), zeal(3), chaotic_energy(20)
4:23.852 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(13), zeal(3), chaotic_energy(20)
4:23.852 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(13), zeal(3), chaotic_energy(20)
4:23.852 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(13), zeal(3), chaotic_energy(20)
4:24.681 Waiting 1.600 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), chaotic_energy(20)
4:26.281 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), chaotic_energy(20)
4:27.354 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(13), zeal(3), chaotic_energy(20)
4:28.184 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power raid_movement, crusade(13), zeal(3), chaotic_energy(20)
4:29.016 Waiting 0.200 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, crusade(15), zeal(3), chaotic_energy(20)
4:29.216 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:29.216 Waiting 0.200 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:29.416 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:30.422 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:31.212 Waiting 0.900 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:32.112 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:33.097 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:33.889 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:34.682 Waiting 1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:35.682 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:36.723 Waiting 0.500 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:37.223 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:38.214 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:39.006 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:39.799 Waiting 1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:40.799 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:42.234 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
4:43.438 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
4:44.644 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement, zeal(3), chaotic_energy(20)
4:45.848 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
4:45.848 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
4:47.055 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
4:48.262 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
4:49.467 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
4:49.467 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
4:50.674 Waiting 2.900 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
4:53.574 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
4:53.574 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
4:54.782 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
4:55.988 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
4:57.194 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
4:58.400 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
4:59.606 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:00.570 shield_of_vengeance Healing_Target 220000.0/220000: 100% mana | 4.0/5: 80% holy_power raid_movement, zeal(3), shield_of_vengeance, chaotic_energy(20)
5:00.814 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power raid_movement, zeal(3), shield_of_vengeance, chaotic_energy(20)
5:02.019 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
5:02.019 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
5:03.224 Waiting 1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
5:04.224 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
5:05.601 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
5:06.806 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
5:08.013 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
5:09.219 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
5:10.423 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
5:11.628 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
5:12.835 Waiting 0.400 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
5:13.235 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
5:14.644 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
5:15.849 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:17.053 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
5:18.259 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
5:18.259 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
5:19.463 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:20.670 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:21.875 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:23.081 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
5:24.288 Waiting 1.000 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:25.288 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:26.668 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:27.874 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
5:29.078 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
5:30.284 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:30.284 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:31.491 Waiting 1.700 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:33.191 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:33.191 Waiting 0.500 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:33.691 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:35.078 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
5:36.284 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:37.489 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:38.694 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:39.899 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:41.105 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
5:42.309 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:43.513 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:44.719 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
5:45.925 Waiting 1.000 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:46.925 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:48.307 Waiting 0.900 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement, zeal(3), chaotic_energy(20)
5:49.207 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:49.207 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:50.411 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:51.618 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:52.824 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:54.028 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:55.233 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:56.437 Waiting 0.100 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
5:56.537 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
5:57.917 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
5:59.122 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
6:00.330 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
6:01.536 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
6:02.741 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
6:03.947 Waiting 1.200 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
6:05.147 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
6:05.147 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
6:06.352 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
6:07.558 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
6:08.763 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
6:09.968 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
6:11.173 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
6:11.173 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
6:12.378 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
6:13.584 Waiting 0.900 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
6:14.484 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
6:15.924 crusade Healing_Target 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
6:15.924 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), chaotic_energy(20)
6:17.130 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), chaotic_energy(20)
6:18.294 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), zeal(3), chaotic_energy(20)
6:19.351 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), zeal(3), chaotic_energy(20)
6:20.408 Waiting 0.200 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement, crusade(4), zeal(3), chaotic_energy(20)
6:20.608 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement, crusade(4), zeal(3), chaotic_energy(20)
6:21.666 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), zeal(3), chaotic_energy(20)
6:21.666 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), zeal(3), chaotic_energy(20)
6:22.634 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), zeal(3), chaotic_energy(20)
6:23.604 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(7), zeal(3), chaotic_energy(20)
6:24.572 Waiting 0.900 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), zeal(3), chaotic_energy(20)
6:25.472 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), zeal(3), chaotic_energy(20)
6:26.565 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(10), zeal(3), chaotic_energy(20)
6:27.459 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(10), zeal(3), chaotic_energy(20)
6:28.353 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(10), zeal(3), chaotic_energy(20)
6:29.247 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), chaotic_energy(20)
6:30.076 Waiting 1.600 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), chaotic_energy(20)
6:31.676 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), chaotic_energy(20)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 26734 25028 13606 (10599)
Agility 3198 3198 0
Stamina 35680 35680 21585
Intellect 7326 7326 0
Spirit 0 0 0
Health 2140800 2140800 0
Mana 220000 220000 0
Holy Power 5 5 0
Spell Power 26734 25028 0
Crit 23.16% 23.16% 6356
Haste 24.84% 23.69% 7699
Damage / Heal Versatility 1.50% 1.50% 599
Attack Power 26734 25028 0
Mastery 24.36% 24.36% 2884
Armor 4184 4184 4184
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 859.00
Local Head Venom-Fanged Barbute
ilevel: 865, stats: { 573 Armor, +2237 Sta, +1491 StrInt, +779 Haste, +601 Mastery }
Local Neck Pendant of the Watchful Eye
ilevel: 825, stats: { +867 Sta, +1099 Haste, +573 Crit }
Local Shoulders Nightsfall Shoulderplates
ilevel: 870, stats: { 535 Armor, +1172 StrInt, +1758 Sta, +618 Haste, +437 Mastery }
Local Chest Breastplate of Preservation
ilevel: 860, stats: { 698 Armor, +1424 StrInt, +2136 Sta, +939 Crit, +416 Mastery }
Local Waist Chain of Thrayn
ilevel: 895, stats: { 424 Armor, +2219 Sta, +1479 StrInt, +413 Crit, +745 Haste }
Local Legs Wracksoul Legplates
ilevel: 845, stats: { 591 Armor, +1238 StrInt, +1857 Sta, +888 Crit, +393 Haste }
Local Feet Warboots of Smoldering Fury
ilevel: 860, stats: { 480 Armor, +1601 Sta, +1068 StrInt, +661 Haste, +355 Mastery }
Local Wrists Wristclamps of Mad Dreams
ilevel: 870, stats: { 312 Armor, +1319 Sta, +879 StrInt, +481 Crit, +311 Haste }
Local Hands Tarnished Dreamkeeper's Gauntlets
ilevel: 865, stats: { 441 Armor, +1678 Sta, +1119 StrInt, +673 Haste, +362 Mastery }
Local Finger1 An'she's Band
ilevel: 845, stats: { +1045 Sta, +1029 Haste, +772 Crit }
Local Finger2 Utgarde Royal Signet
ilevel: 860, stats: { +1201 Sta, +1307 Crit, +599 Vers }
Local Trinket1 Chaos Talisman
ilevel: 840, stats: { +898 Haste }
Local Trinket2 Ursoc's Rending Paw
ilevel: 855, stats: { +1292 Str }
Local Back Evergreen Vinewrap Drape
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +493 Haste, +241 Crit }
Local Main Hand Ashbringer
ilevel: 880, weapon: { 8875 - 13315, 3.6 }, stats: { +1715 Str, +2573 Sta, +742 Crit, +713 Mastery }, relics: { +45 ilevels, +48 ilevels, +37 ilevels }

Talents

Level
15 Final Verdict (Retribution Paladin) Execution Sentence (Retribution Paladin) Consecration (Retribution Paladin)
30 The Fires of Justice (Retribution Paladin) Zeal (Retribution Paladin) Greater Judgment (Retribution Paladin)
45 Fist of Justice Repentance Blinding Light
60 Virtue's Blade (Retribution Paladin) Blade of Wrath (Retribution Paladin) Divine Hammer (Retribution Paladin)
75 Justicar's Vengeance (Retribution Paladin) Eye for an Eye (Retribution Paladin) Word of Glory (Retribution Paladin)
90 Divine Intervention (Retribution Paladin) Cavalier (Retribution Paladin) Seal of Light (Retribution Paladin)
100 Divine Purpose (Retribution Paladin) Crusade (Retribution Paladin) Holy Wrath (Retribution Paladin)

Profile

paladin="Zipi"
origin="https://us.api.battle.net/wow/character/thrall/Zipi/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/146/160036754-avatar.jpg"
level=110
race=tauren
role=attack
position=back
professions=mining=706/herbalism=633
talents=2231223
artifact=2:0:0:0:0:40:1:41:3:42:3:43:3:47:2:50:3:51:3:53:3:350:1:351:1:353:1:1275:1
spec=retribution

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_countless_armies
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/greater_blessing_of_might
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/rebuke
actions+=/potion,name=old_war,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up|target.time_to_die<=40)
actions+=/holy_wrath
actions+=/avenging_wrath
actions+=/shield_of_vengeance
actions+=/crusade,if=holy_power>=5
actions+=/wake_of_ashes,if=holy_power>=0&time<2
actions+=/execution_sentence,if=spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent,if=holy_power<5
actions+=/call_action_list,name=VB,if=talent.virtues_blade.enabled
actions+=/call_action_list,name=DH,if=talent.divine_hammer.enabled

actions.DH=divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.DH+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.DH+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
actions.DH+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.DH+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
actions.DH+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.DH+=/wake_of_ashes,if=holy_power<=1
actions.DH+=/zeal,if=charges=2&holy_power<=4
actions.DH+=/crusader_strike,if=charges=2&holy_power<=4
actions.DH+=/divine_hammer,if=holy_power<=3
actions.DH+=/judgment
actions.DH+=/consecration
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*6)
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.DH+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
actions.DH+=/templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions.DH+=/templars_verdict,if=debuff.judgment.up&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*6)
actions.DH+=/zeal,if=holy_power<=4
actions.DH+=/crusader_strike,if=holy_power<=4

actions.VB=divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.VB+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/wake_of_ashes,if=holy_power=0|holy_power=1&cooldown.blade_of_justice.remains>gcd|holy_power=2&(cooldown.zeal.charges_fractional<=0.34|cooldown.crusader_strike.charges_fractional<=0.34)
actions.VB+=/zeal,if=charges=2&holy_power<=4
actions.VB+=/crusader_strike,if=charges=2&holy_power<=4
actions.VB+=/blade_of_justice,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
actions.VB+=/judgment,if=holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&cooldown.blade_of_justice.remains>gcd)|(talent.greater_judgment.enabled&target.health.pct>50)
actions.VB+=/consecration
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.VB+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
actions.VB+=/templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/zeal,if=holy_power<=4
actions.VB+=/crusader_strike,if=holy_power<=4
actions.VB+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)

head=venomfanged_barbute,id=139229,bonus_id=1805/1487
neck=pendant_of_the_watchful_eye,id=137536,bonus_id=1726/1477
shoulders=nightsfall_shoulderplates,id=139060,bonus_id=3432/1532/3337
back=evergreen_vinewrap_drape,id=139248,bonus_id=1807/1472
chest=breastplate_of_preservation,id=134500,bonus_id=3412/1512/3336
wrists=wristclamps_of_mad_dreams,id=139235,bonus_id=1807/1492/3337
hands=tarnished_dreamkeepers_gauntlets,id=141695,bonus_id=1805/1487
waist=chain_of_thrayn,id=137086,bonus_id=1811
legs=wracksoul_legplates,id=121280,bonus_id=3432/1507/3336
feet=warboots_of_smoldering_fury,id=141437,bonus_id=1472
finger1=anshes_band,id=139103,bonus_id=3432/1507/3336
finger2=utgarde_royal_signet,id=133637,bonus_id=3411/1512/3337
trinket1=chaos_talisman,id=137459,bonus_id=1727/1492/1813
trinket2=ursocs_rending_paw,id=139328,bonus_id=1807/1477/3336
main_hand=ashbringer,id=120978,bonus_id=737,gem_id=141276/141522/141260/0,relic_id=3397:1517:3337/1477:3336/3396:1492:3339/0

# Gear Summary
# gear_ilvl=859.00
# gear_strength=13606
# gear_stamina=21585
# gear_crit_rating=6356
# gear_haste_rating=7699
# gear_mastery_rating=2884
# gear_versatility_rating=599
# gear_armor=4184

Faelik

Faelik : 428115 dps, 293408 dps to main target

  • Race: Undead
  • Class: Priest
  • Spec: Shadow
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
428114.6 428114.6 450.8 / 0.105% 89755.0 / 21.0% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.96% 52.6 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Faelik/advanced
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Mind Bomb (Shadow Priest)
  • 60: Void Lord (Shadow Priest)
  • 75: Auspicious Spirits (Shadow Priest)
  • 90: Power Infusion (Shadow Priest)
  • 100: Legacy of the Void (Shadow Priest)
  • Talent Calculator
Artifact
Professions
  • alchemy: 575
  • herbalism: 800
Scale Factors for Faelik Damage Per Second
Haste Crit Int Mastery Vers
Scale Factors 14.72 13.29 13.01 12.84 10.78
Normalized 1.13 1.02 1.00 0.99 0.83
Scale Deltas 1138 1138 1138 1138 1138
Error 0.56 0.57 0.57 0.57 0.57
Gear Ranking
Optimizers
Ranking
  • Haste > Crit ~= Int ~= Mastery > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=13.01, CritRating=13.29, HasteRating=14.72, MasteryRating=12.84, Versatility=10.78 )

Scale Factors for other metrics

Scale Factors for Faelik Damage Per Second
Haste Crit Int Mastery Vers
Scale Factors 14.72 13.29 13.01 12.84 10.78
Normalized 1.13 1.02 1.00 0.99 0.83
Scale Deltas 1138 1138 1138 1138 1138
Error 0.56 0.57 0.57 0.57 0.57
Gear Ranking
Optimizers
Ranking
  • Haste > Crit ~= Int ~= Mastery > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=13.01, CritRating=13.29, HasteRating=14.72, MasteryRating=12.84, Versatility=10.78 )
Scale Factors for Faelik Priority Target Damage Per Second
Haste Crit Int Mastery Vers
Scale Factors 9.80 9.71 8.77 8.38 7.33
Normalized 1.12 1.11 1.00 0.96 0.84
Scale Deltas 1138 1138 1138 1138 1138
Error 0.21 0.21 0.21 0.21 0.21
Gear Ranking
Optimizers
Ranking
  • Haste ~= Crit > Int > Mastery > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=8.77, CritRating=9.71, HasteRating=9.80, MasteryRating=8.38, Versatility=7.33 )
Scale Factors for Faelik Damage Per Second (Effective)
Haste Crit Int Mastery Vers
Scale Factors 14.72 13.29 13.01 12.84 10.78
Normalized 1.13 1.02 1.00 0.99 0.83
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Haste > Crit > Int > Mastery > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=13.01, CritRating=13.29, HasteRating=14.72, MasteryRating=12.84, Versatility=10.78 )
Scale Factors for Faelik Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for FaelikTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Faelik 428115
Deadly Grace 9585 2.2% 29.6 13.99sec 127967 0 Direct 29.6 96571 193527 128132 32.6%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.59 29.56 0.00 0.00 0.0000 0.0000 3786982.57 3786982.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.93 67.45% 96570.91 87722 105266 96555.69 90061 102496 1925082 1925082 0.00
crit 9.62 32.55% 193527.02 175443 210532 193509.28 175443 210532 1861900 1861900 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mark of the Hidden Satyr 10510 2.5% 30.7 12.95sec 137233 0 Direct 30.7 103388 206933 137233 32.7%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.67 30.67 0.00 0.00 0.0000 0.0000 4209487.25 4209487.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.65 67.31% 103388.46 91714 110056 103384.09 95382 110056 2134711 2134711 0.00
crit 10.03 32.69% 206933.07 183427 220113 206917.25 183427 220113 2074776 2074776 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Mind Blast 32875 7.7% 56.5 7.01sec 233028 238405 Direct 57.5 172416 345356 228976 32.7%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.46 57.46 0.00 0.00 0.9775 0.0000 13156874.08 13156874.08 0.00 238405.31 238405.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.67 67.30% 172416.36 125318 195496 172426.00 160824 184257 6667229 6667229 0.00
crit 18.79 32.70% 345355.82 250635 390991 345390.00 295750 386647 6489645 6489645 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=12} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 16860 4.0% 55.7 7.24sec 123904 82630 Periodic 150.3 34575 69273 45936 32.7% 18.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.72 0.00 150.30 150.30 1.4995 0.4850 6904145.56 6904145.56 0.00 82629.95 82629.95
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 101.1 67.26% 34575.30 25065 39101 34560.51 31699 37512 3495186 3495186 0.00
crit 49.2 32.74% 69272.51 50027 78202 69260.78 61081 76759 3408960 3408960 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.mind_spike.enabled
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}$?s120585[. Each time Mind Flay deals damage, the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]$?a185916[ |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.550000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Mind Sear 44027 10.2% 34.7 8.19sec 500535 345570 Periodic 464.5 28172 56346 37418 32.8% 10.2%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.72 0.00 82.61 464.46 1.4484 0.4947 17379078.24 17379078.24 0.00 345570.35 345570.35
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 312.0 67.18% 28171.51 20507 31990 28182.65 25568 29904 8790405 8790405 0.00
crit 152.4 32.82% 56346.26 41013 63980 56371.34 50570 60584 8588673 8588673 0.00
 
 

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing Shadow damage to all targets within $49821a2 yards.
  • description:Corrosive shadow energy radiates from the target, dealing ${$49821m2*6} Shadow damage over {$48045d=5 seconds} to all enemies within $49821a2 yards of the target. |cFFFFFFFFGenerates ${$208232m1*6/100} Insanity over the duration per target hit.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a2 yards.
  • description:{$@spelldesc48045=Corrosive shadow energy radiates from the target, dealing ${$49821m2*6} Shadow damage over {$48045d=5 seconds} to all enemies within $49821a2 yards of the target. |cFFFFFFFFGenerates ${$208232m1*6/100} Insanity over the duration per target hit.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.540000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Shadow Word: Death 5018 1.2% 7.8 10.09sec 255355 265062 Direct 7.8 192261 384356 255350 32.8%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.83 7.83 0.00 0.00 0.9634 0.0000 1999097.15 1999097.15 0.00 265061.94 265061.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.26 67.15% 192260.77 152547 198311 192292.91 0 198311 1010792 1010792 0.00
crit 2.57 32.85% 384355.52 305094 396623 366057.79 0 396623 988305 988305 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=10} Insanity, or $/100;190714s1 if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.250000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 59773 (72902) 14.0% (17.0%) 46.4 8.44sec 626950 650789 Direct 46.4 39727 79608 52751 32.7%  
Periodic 334.5 48270 96612 64082 32.7% 104.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.38 46.38 334.52 334.52 0.9634 1.2451 23883789.54 23883789.54 0.00 63051.98 650789.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.24 67.34% 39727.14 25553 74942 39763.07 33302 46196 1240931 1240931 0.00
crit 15.15 32.66% 79608.30 51106 149885 79685.03 52242 103620 1205916 1205916 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 225.1 67.29% 48269.69 147 85753 48293.69 44303 52263 10865695 10865695 0.00
crit 109.4 32.71% 96612.21 1885 171507 96617.28 85916 108087 10571247 10571247 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<(3+(4%3))*gcd
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=14 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.410000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.450000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Sphere of Insanity 13129 3.0% 276.0 1.40sec 18828 0 Direct 372.6 13948 0 13948 0.0%  

Stats details: sphere_of_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 276.00 372.57 0.00 0.00 0.0000 0.0000 5196729.86 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 372.57 100.00% 13948.21 7896 47974 13963.74 11597 16937 5196730 0 0.00
 
 

Action details: sphere_of_insanity

Static Values
  • id:194182
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194182
  • name:Sphere of Insanity
  • school:physical
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
 
Shadowy Apparitions 19254 4.5% 199.7 1.99sec 38461 0 Direct 198.1 29027 58117 38768 33.5%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 199.68 198.10 0.00 0.00 0.0000 0.0000 7679820.68 7679820.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 131.76 66.51% 29027.28 20886 32583 29030.07 27507 30357 3824706 3824706 0.00
crit 66.33 33.49% 58116.94 41773 65165 58120.34 53671 62167 3855115 3855115 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.275000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Touch of the Grave 3317 0.8% 25.3 16.10sec 52577 0 Direct 25.3 52577 0 52577 0.0%  

Stats details: touch_of_the_grave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.26 25.26 0.00 0.00 0.0000 0.0000 1328119.31 1328119.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.26 100.00% 52577.22 37975 59241 52585.45 49434 56030 1328119 1328119 0.00
 
 

Action details: touch_of_the_grave

Static Values
  • id:127802
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:127802
  • name:Touch of the Grave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc5227=Your attacks and damaging spells have a chance to drain the target, dealing ${$max($AP,$SPH)*$pctD*(1+$@versadmg)} Shadow damage and healing you for the same amount. Additionally, you can breathe underwater indefinitely.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Vampiric Touch 126064 29.3% 39.2 7.79sec 1277520 1330669 Periodic 458.1 82329 164770 109351 32.8% 207.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.22 0.00 458.14 458.14 0.9601 1.8127 50098338.36 50098338.36 0.00 57710.00 1330668.50
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 308.0 67.22% 82329.20 550 145216 82324.24 73892 90163 25354659 25354659 0.00
crit 150.2 32.78% 164769.88 710 293427 164731.80 143686 185985 24743680 24743680 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.vampiric_touch.remains<(4+(4%3))*gcd
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=18 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.790000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 55171 12.9% 91.8 4.17sec 240353 256472 Direct 91.6 181534 363087 241051 32.8%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.82 91.55 0.00 0.00 0.9372 0.0000 22068350.62 22068350.62 0.00 256471.55 256471.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.54 67.22% 181534.16 121474 189499 181546.97 176389 186728 11171130 11171130 0.00
crit 30.01 32.78% 363087.15 242947 378997 363112.23 345557 378997 10897220 10897220 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage$?a231688[ and refreshing Shadow Word: Pain and Vampiric Touch to their original duration][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 10342 2.4% 10.8 37.43sec 379349 0 Direct 50.7 61167 122311 81143 32.7%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.83 50.65 0.00 0.00 0.0000 0.0000 4110244.67 4110244.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.10 67.33% 61167.09 56964 68356 61204.99 57357 67543 2085994 2085994 0.00
crit 16.55 32.67% 122310.78 113927 136713 122377.64 113927 136713 2024251 2024251 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 14613 3.4% 6.8 62.10sec 867722 275978 Periodic 37.0 119292 238331 158312 32.8% 4.8%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.75 0.00 37.00 37.00 3.1442 0.5171 5857364.51 5857364.51 0.00 275978.35 275978.35
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.9 67.22% 119291.54 201 130332 119308.68 99261 130332 2966816 2966816 0.00
crit 12.1 32.78% 238330.64 401 260664 238417.39 181844 260664 2890549 2890549 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.200000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - shadowfiend 109643 / 7577
melee 109643 1.8% 32.6 8.72sec 93347 122241 Direct 32.6 70331 140683 93347 32.7%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.56 32.56 0.00 0.00 0.7636 0.0000 3039154.49 3039154.49 0.00 122240.95 122240.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.91 67.28% 70330.58 62845 72272 70323.68 67987 72272 1540691 1540691 0.00
crit 10.65 32.72% 140683.02 125690 144543 140664.67 128832 144543 1498464 1498464 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Faelik
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Faelik
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Faelik
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Faelik
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Power Infusion 3.6 122.17sec

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.insanity_drain_stacks.stack>=85
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Haste increased by {$s1=25}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses you with power for {$d=20 seconds}, increasing haste by {$s1=25}%{$?s185916=false}[ and increasing Insanity generation by {$s3=25}%][ and reducing the mana cost of all spells by {$s2=20}%].
 
Shadowfiend 2.4 197.98sec

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.35 0.00 0.00 0.00 0.9146 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&!talent.surrender_to_madness.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Summons a shadowy fiend to attack the target for {$d=12 seconds}.
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 
pet - shadowfiend
Shadowcrawl 4.7 74.24sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.67 0.00 0.00 0.00 0.9050 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 10.13% 0.0(0.0) 1.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Burning Intensity 4.7 0.0 74.2sec 73.9sec 22.64% 22.64% 4.4(4.4) 4.4

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_burning_intensity
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:337.58

Stack Uptimes

  • burning_intensity_1:1.16%
  • burning_intensity_2:1.16%
  • burning_intensity_3:1.15%
  • burning_intensity_4:1.15%
  • burning_intensity_5:1.15%
  • burning_intensity_6:1.15%
  • burning_intensity_7:1.14%
  • burning_intensity_8:1.14%
  • burning_intensity_9:1.14%
  • burning_intensity_10:1.13%
  • burning_intensity_11:1.13%
  • burning_intensity_12:1.13%
  • burning_intensity_13:1.12%
  • burning_intensity_14:1.12%
  • burning_intensity_15:1.12%
  • burning_intensity_16:1.12%
  • burning_intensity_17:1.11%
  • burning_intensity_18:1.11%
  • burning_intensity_19:1.11%
  • burning_intensity_20:1.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:215816
  • name:Burning Intensity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc215813=Your damaging spells have a chance to grant you {$215816s1=319} Critical Strike every $215815t2 sec for {$215815d=20 seconds}.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
insanity_drain_stacks 10.8 266.5 37.5sec 37.5sec 72.57% 72.57% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:3.86%
  • insanity_drain_stacks_2:2.74%
  • insanity_drain_stacks_3:2.72%
  • insanity_drain_stacks_4:2.74%
  • insanity_drain_stacks_5:2.71%
  • insanity_drain_stacks_6:2.67%
  • insanity_drain_stacks_7:2.73%
  • insanity_drain_stacks_8:2.68%
  • insanity_drain_stacks_9:2.66%
  • insanity_drain_stacks_10:2.79%
  • insanity_drain_stacks_11:2.84%
  • insanity_drain_stacks_12:2.77%
  • insanity_drain_stacks_13:3.08%
  • insanity_drain_stacks_14:3.08%
  • insanity_drain_stacks_15:2.71%
  • insanity_drain_stacks_16:2.80%
  • insanity_drain_stacks_17:2.92%
  • insanity_drain_stacks_18:2.76%
  • insanity_drain_stacks_19:2.73%
  • insanity_drain_stacks_20:2.67%
  • insanity_drain_stacks_21:2.26%
  • insanity_drain_stacks_22:1.95%
  • insanity_drain_stacks_23:1.65%
  • insanity_drain_stacks_24:1.28%
  • insanity_drain_stacks_25:1.05%
  • insanity_drain_stacks_26:0.89%
  • insanity_drain_stacks_27:0.78%
  • insanity_drain_stacks_28:0.73%
  • insanity_drain_stacks_29:0.71%
  • insanity_drain_stacks_30:0.70%
  • insanity_drain_stacks_31:0.68%
  • insanity_drain_stacks_32:0.65%
  • insanity_drain_stacks_33:0.55%
  • insanity_drain_stacks_34:0.45%
  • insanity_drain_stacks_35:0.38%
  • insanity_drain_stacks_36:0.33%
  • insanity_drain_stacks_37:0.28%
  • insanity_drain_stacks_38:0.24%
  • insanity_drain_stacks_39:0.17%
  • insanity_drain_stacks_40:0.10%
  • insanity_drain_stacks_41:0.04%
  • insanity_drain_stacks_42:0.01%
  • insanity_drain_stacks_43:0.00%
  • insanity_drain_stacks_44:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Lingering Insanity 10.8 0.0 35.5sec 35.5sec 43.51% 90.59% 0.0(0.0) 9.6

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_15:0.00%
  • lingering_insanity_16:0.00%
  • lingering_insanity_17:0.02%
  • lingering_insanity_18:0.12%
  • lingering_insanity_19:0.58%
  • lingering_insanity_20:2.08%
  • lingering_insanity_21:5.38%
  • lingering_insanity_22:4.29%
  • lingering_insanity_23:2.82%
  • lingering_insanity_24:2.76%
  • lingering_insanity_25:2.26%
  • lingering_insanity_26:2.38%
  • lingering_insanity_27:2.53%
  • lingering_insanity_28:2.00%
  • lingering_insanity_29:1.71%
  • lingering_insanity_30:0.85%
  • lingering_insanity_31:0.56%
  • lingering_insanity_32:0.40%
  • lingering_insanity_33:0.22%
  • lingering_insanity_34:0.29%
  • lingering_insanity_35:0.66%
  • lingering_insanity_36:2.80%
  • lingering_insanity_37:1.69%
  • lingering_insanity_38:1.02%
  • lingering_insanity_39:0.58%
  • lingering_insanity_40:0.50%
  • lingering_insanity_41:0.69%
  • lingering_insanity_42:1.00%
  • lingering_insanity_43:1.22%
  • lingering_insanity_44:1.09%
  • lingering_insanity_45:0.73%
  • lingering_insanity_46:0.23%
  • lingering_insanity_47:0.06%
  • lingering_insanity_48:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197937
  • name:Lingering Insanity
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc194249={$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}}
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
mind_sear_on_hit_reset 14.1 20.7 20.8sec 8.2sec 29.94% 29.94% 0.0(0.0) 14.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_mind_sear_on_hit_reset
  • max_stacks:2
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • mind_sear_on_hit_reset_1:29.94%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of Deadly Grace 2.0 0.0 363.8sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Power Infusion 3.6 0.0 122.2sec 122.2sec 17.47% 17.47% 0.0(0.0) 3.4

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • power_infusion_1:17.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Haste increased by {$s1=25}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses you with power for {$d=20 seconds}, increasing haste by {$s1=25}%{$?s185916=false}[ and increasing Insanity generation by {$s3=25}%][ and reducing the mana cost of all spells by {$s2=20}%].
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.53% 14.53% 2.0(2.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Sphere of Insanity 10.8 0.0 37.5sec 37.5sec 72.57% 75.22% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_sphere_of_insanity
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • sphere_of_insanity_1:72.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194182
  • name:Sphere of Insanity
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:0.00%
Twist of Fate 8.5 865.3 29.6sec 0.4sec 66.40% 66.40% 865.3(865.3) 7.5

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:66.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 6.8 0.0 62.1sec 62.1sec 5.03% 5.03% 0.0(0.0) 3.5

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:5.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 10.8 0.0 37.5sec 37.5sec 72.57% 74.67% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_1:2.70%
  • voidform_2:2.69%
  • voidform_3:2.69%
  • voidform_4:2.68%
  • voidform_5:2.67%
  • voidform_6:2.67%
  • voidform_7:2.66%
  • voidform_8:2.65%
  • voidform_9:2.65%
  • voidform_10:2.64%
  • voidform_11:2.63%
  • voidform_12:2.62%
  • voidform_13:2.62%
  • voidform_14:2.61%
  • voidform_15:2.60%
  • voidform_16:2.60%
  • voidform_17:2.59%
  • voidform_18:2.58%
  • voidform_19:2.56%
  • voidform_20:2.48%
  • voidform_21:2.26%
  • voidform_22:1.93%
  • voidform_23:1.75%
  • voidform_24:1.57%
  • voidform_25:1.41%
  • voidform_26:1.28%
  • voidform_27:1.12%
  • voidform_28:0.97%
  • voidform_29:0.85%
  • voidform_30:0.78%
  • voidform_31:0.74%
  • voidform_32:0.71%
  • voidform_33:0.69%
  • voidform_34:0.67%
  • voidform_35:0.64%
  • voidform_36:0.54%
  • voidform_37:0.42%
  • voidform_38:0.35%
  • voidform_39:0.31%
  • voidform_40:0.28%
  • voidform_41:0.25%
  • voidform_42:0.20%
  • voidform_43:0.14%
  • voidform_44:0.08%
  • voidform_45:0.03%
  • voidform_46:0.01%
  • voidform_47:0.00%
  • voidform_48:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend: raid_movement 0.4 0.0 0.0sec 0.0sec 4.78% 4.78% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:4.79%

Trigger Attempt Success

  • trigger_pct:36.68%
shadowfiend: Shadowcrawl 4.7 0.0 74.5sec 74.5sec 83.42% 79.36% 0.0(0.0) 4.6

Buff details

  • buff initial source:Faelik_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:83.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowform

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Faelik
Resource Gains Type Count Total Average Overflow
Insanity Gained from Auspicious Spirits Insanity 198.09 756.63 (1350.01%) 3.82 35.75 4.51%
Insanity Drained by Voidform Insanity 5807.65 -4422.93 (-7891.58%) -0.76 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 57.46 678.50 (1210.60%) 11.81 11.03 1.60%
Insanity Gained from Mind Flay Insanity 150.30 300.52 (536.21%) 2.00 0.07 0.02%
Insanity Gained from Mind Sear Insanity 464.46 636.87 (1136.33%) 1.37 59.82 8.59%
Insanity Gained from Power Infusion Insanity 261.22 217.54 (388.15%) 0.83 58.12 21.08%
Insanity Gained from Shadow Word: Death Insanity 7.83 76.45 (136.40%) 9.76 2.03 2.58%
Insanity Gained from Shadow Word: Pain Casts Insanity 46.38 139.06 (248.12%) 3.00 0.09 0.07%
Insanity Gained from Vampiric Touch Casts Insanity 39.22 156.81 (279.80%) 4.00 0.05 0.03%
Insanity Gained from Void Bolt Insanity 91.82 1239.59 (2211.73%) 13.50 229.46 15.62%
Insanity Saved by Void Torrent Insanity 401.83 277.00 (494.24%) 0.69 0.00 0.00%
Health from Vampiric Touch Ticks Health 458.13 0.00 (0.00%) 0.00 25048829.64 100.00%
mp5_regen Mana 926.57 0.00 (0.00%) 0.00 3521492.00 100.00%
Resource RPS-Gain RPS-Loss
Insanity 11.18 11.04
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 55.82 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 199.7 2.0sec
Void Eruption casted when a target with both DoTs was up 12.1 37.5sec
Void Eruption casted when a target with no DoTs was up 9.8 45.2sec
Void Eruption casted when a target with only Shadow Word: Pain was up 0.4 118.0sec
Void Eruption casted when a target with only Vampiric Touch was up 26.1 36.8sec

Statistics & Data Analysis

Fight Length
Sample Data Faelik Fight Length
Count 9999
Mean 400.62
Minimum 307.54
Maximum 499.01
Spread ( max - min ) 191.47
Range [ ( max - min ) / 2 * 100% ] 23.90%
DPS
Sample Data Faelik Damage Per Second
Count 9999
Mean 428114.59
Minimum 369076.03
Maximum 513978.84
Spread ( max - min ) 144902.81
Range [ ( max - min ) / 2 * 100% ] 16.92%
Standard Deviation 22999.7275
5th Percentile 393860.00
95th Percentile 470219.34
( 95th Percentile - 5th Percentile ) 76359.34
Mean Distribution
Standard Deviation 230.0088
95.00% Confidence Intervall ( 427663.78 - 428565.40 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 110
0.1% Error 11087
0.1 Scale Factor Error with Delta=300 4515741
0.05 Scale Factor Error with Delta=300 18062965
0.01 Scale Factor Error with Delta=300 451574127
Priority Target DPS
Sample Data Faelik Priority Target Damage Per Second
Count 9999
Mean 293408.20
Minimum 265509.06
Maximum 328327.07
Spread ( max - min ) 62818.01
Range [ ( max - min ) / 2 * 100% ] 10.70%
Standard Deviation 8564.9435
5th Percentile 279391.91
95th Percentile 307542.34
( 95th Percentile - 5th Percentile ) 28150.43
Mean Distribution
Standard Deviation 85.6537
95.00% Confidence Intervall ( 293240.32 - 293576.07 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3273
0.1 Scale Factor Error with Delta=300 626228
0.05 Scale Factor Error with Delta=300 2504913
0.01 Scale Factor Error with Delta=300 62622827
DPS(e)
Sample Data Faelik Damage Per Second (Effective)
Count 9999
Mean 428114.59
Minimum 369076.03
Maximum 513978.84
Spread ( max - min ) 144902.81
Range [ ( max - min ) / 2 * 100% ] 16.92%
Damage
Sample Data Faelik Damage
Count 9999
Mean 167658422.39
Minimum 129866315.83
Maximum 203111100.16
Spread ( max - min ) 73244784.34
Range [ ( max - min ) / 2 * 100% ] 21.84%
DTPS
Sample Data Faelik Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Faelik Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Faelik Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Faelik Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Faelik Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Faelik Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data FaelikTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Faelik Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
0.00 variable,op=set,name=actors_fight_time_mod,value=0
0.00 variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
0.00 variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
0.00 variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
0.00 variable,op=min,name=s2mcheck,value=180
8 0.00 call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
9 0.00 call_action_list,name=vf,if=buff.voidform.up
A 0.00 call_action_list,name=main
actions.main
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
B 2.12 shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
C 1.14 vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
D 10.84 void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
E 1.69 shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
F 1.04 shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
0.00 shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
G 14.23 mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
0.00 mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
H 26.31 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
I 6.73 mind_sear,if=active_enemies>=3,interrupt=1,chain=1
J 10.39 mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
0.00 mind_spike,if=talent.mind_spike.enabled
K 14.78 shadow_word_pain
actions.vf
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
L 3.56 power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
0.00 power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
0.00 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
0.00 berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
M 19.03 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
N 0.90 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
O 1.03 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
P 70.93 void_bolt
Q 6.75 void_torrent,if=!talent.surrender_to_madness.enabled
0.00 void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
R 2.07 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
0.00 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
S 46.38 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
T 4.72 shadow_word_death,if=cooldown.shadow_word_death.charges=2
U 2.35 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
V 0.01 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
W 0.07 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
X 14.40 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
Y 27.49 mind_sear,if=active_enemies>=3,interrupt=1
Z 33.50 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
a 27.78 shadow_word_pain

Sample Sequence

012456BCJGJBJKDQOSZMaLaMSXMXXMUSPYPSPYPSPYPSPZPaSPZPKKKKGHHHHHIKGDYPYPSYPZPQaPSZMaaMSHHHHIKGDYPYPSZPZPSZPaaMaSHHHHHIEDSaPYSPYPSZPQMSLXMXXMSXMXYPSYPYPPaSPYPSZPZGJKKKGHEEDXXMSYPYSPYPSZPZPSQMaaMaSHHHHIDSYPYSPYaPSZPZPSUMaaGHKHHHIGDYPYPSZPaZPSQMaLaMSXMXXMaSPYPSYPYSPYPSZPZKGJKKKGEDXXMXXMaSPYPSYPZPSZPaQPSTPRZGJJGJDZPSTPZPSaPZPSTPZ7GJFJGDZPZPSTPQPSLZPZPSTPZPS

Sample Sequence Table

time name target resources buffs
Pre flask Faelik 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre food Faelik 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre augmentation Faelik 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
Pre shadowform Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.000 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:01.188 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity bloodlust, potion_of_deadly_grace
0:02.147 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.0/100: 19% insanity bloodlust, potion_of_deadly_grace
0:06.777 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.0/100: 41% insanity bloodlust, potion_of_deadly_grace
0:07.734 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.0/100: 53% insanity bloodlust, potion_of_deadly_grace
0:10.317 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.0/100: 67% insanity bloodlust, potion_of_deadly_grace
0:11.274 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity bloodlust, potion_of_deadly_grace
0:12.573 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity bloodlust, raid_movement, potion_of_deadly_grace
0:13.532 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity bloodlust, potion_of_deadly_grace
0:13.532 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity bloodlust, sphere_of_insanity, voidform, insanity_drain_stacks, potion_of_deadly_grace
0:17.745 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.7/100: 81% insanity bloodlust, sphere_of_insanity, voidform(5), insanity_drain_stacks(2), potion_of_deadly_grace
0:18.657 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.5/100: 88% insanity bloodlust, sphere_of_insanity, voidform(6), insanity_drain_stacks(3), potion_of_deadly_grace
0:19.562 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.5/100: 95% insanity bloodlust, sphere_of_insanity, voidform(7), insanity_drain_stacks(4), potion_of_deadly_grace
0:20.801 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 82.7/100: 83% insanity bloodlust, raid_movement, sphere_of_insanity, voidform(8), insanity_drain_stacks(5), potion_of_deadly_grace
0:21.687 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.8/100: 89% insanity bloodlust, raid_movement, sphere_of_insanity, voidform(9), insanity_drain_stacks(6), potion_of_deadly_grace
0:22.566 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.4/100: 82% insanity bloodlust, raid_movement, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace
0:22.566 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.4/100: 82% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace
0:23.320 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 77.2/100: 77% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(10), insanity_drain_stacks(7)
0:24.069 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.2/100: 88% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(11), insanity_drain_stacks(8)
0:24.821 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 93.9/100: 94% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(12), insanity_drain_stacks(9)
0:25.574 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 89.1/100: 89% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(13), insanity_drain_stacks(10)
0:26.330 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 95.2/100: 95% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(13), insanity_drain_stacks(10)
0:27.080 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 89.9/100: 90% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(14), insanity_drain_stacks(11)
0:27.830 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 84.4/100: 84% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(15), insanity_drain_stacks(12)
0:28.583 shadowfiend Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(16), insanity_drain_stacks(13)
0:29.337 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.4/100: 77% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(16), insanity_drain_stacks(13)
0:30.085 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.2/100: 81% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(17), insanity_drain_stacks(14)
0:30.838 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.4/100: 88% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(18), insanity_drain_stacks(15)
0:31.976 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.2/100: 99% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(19), insanity_drain_stacks(16), mind_sear_on_hit_reset
0:32.775 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.8/100: 88% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(20), insanity_drain_stacks(17), mind_sear_on_hit_reset
0:33.936 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.4/100: 87% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(18)
0:34.690 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.5/100: 95% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(19)
0:35.710 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.4/100: 96% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(20), mind_sear_on_hit_reset
0:36.569 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.4/100: 91% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(21), mind_sear_on_hit_reset
0:37.667 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.5/100: 86% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(22)
0:38.422 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.7/100: 91% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(22)
0:39.418 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.0/100: 97% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(23), mind_sear_on_hit_reset
0:40.240 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(24), mind_sear_on_hit_reset
0:41.289 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.2/100: 83% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(25)
0:42.147 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.2/100: 88% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(29), insanity_drain_stacks(26)
0:43.944 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.5/100: 61% insanity twist_of_fate, sphere_of_insanity, voidform(31), insanity_drain_stacks(28)
0:44.898 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.2/100: 60% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(32), insanity_drain_stacks(29)
0:45.839 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.3/100: 49% insanity twist_of_fate, sphere_of_insanity, voidform(33), insanity_drain_stacks(30)
0:46.776 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.4/100: 40% insanity twist_of_fate, sphere_of_insanity, voidform(34), insanity_drain_stacks(31)
0:47.703 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.6/100: 38% insanity twist_of_fate, sphere_of_insanity, voidform(35), insanity_drain_stacks(32)
0:49.688 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.4/100: 4% insanity sphere_of_insanity, voidform(37), insanity_drain_stacks(34)
0:50.596 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, lingering_insanity(38)
0:51.500 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/100: 3% insanity raid_movement, lingering_insanity(38)
0:52.402 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity raid_movement, lingering_insanity(38)
0:53.305 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 9.0/100: 9% insanity raid_movement, lingering_insanity(38)
0:54.209 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(38)
0:55.114 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity lingering_insanity(38)
0:56.017 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(38)
0:56.921 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity lingering_insanity(38)
0:57.825 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 40.0/100: 40% insanity lingering_insanity(38)
0:58.728 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 44.0/100: 44% insanity lingering_insanity(38)
0:59.630 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity lingering_insanity(38)
1:00.794 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.0/100: 57% insanity raid_movement, lingering_insanity(38), mind_sear_on_hit_reset
1:01.699 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity lingering_insanity(38), mind_sear_on_hit_reset
1:02.602 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity lingering_insanity(38), mind_sear_on_hit_reset
1:02.602 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity sphere_of_insanity, voidform, lingering_insanity(38), insanity_drain_stacks, mind_sear_on_hit_reset
1:04.374 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.2/100: 82% insanity twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(38), insanity_drain_stacks(2), mind_sear_on_hit_reset
1:05.251 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.0/100: 93% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(38), insanity_drain_stacks(3), mind_sear_on_hit_reset
1:06.727 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.9/100: 97% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(38), insanity_drain_stacks(5), mind_sear_on_hit_reset
1:07.835 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.7/100: 99% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(38), insanity_drain_stacks(6), mind_sear_on_hit_reset
1:08.687 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(38), insanity_drain_stacks(7), mind_sear_on_hit_reset
1:10.223 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.2/100: 95% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(38), insanity_drain_stacks(8), mind_sear_on_hit_reset
1:11.228 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.3/100: 87% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
1:13.739 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.7/100: 66% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12)
1:14.848 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
1:16.255 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.5/100: 66% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(13)
1:17.341 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.8/100: 53% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(14)
1:18.415 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.4/100: 51% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(15)
1:19.488 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.6/100: 55% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(16)
1:20.935 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 30.1/100: 30% insanity raid_movement, sphere_of_insanity, voidform(19), insanity_drain_stacks(18)
1:21.978 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.8/100: 32% insanity raid_movement, sphere_of_insanity, voidform(20), insanity_drain_stacks(19)
1:23.013 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.9/100: 16% insanity raid_movement, sphere_of_insanity, voidform(21), insanity_drain_stacks(20)
1:24.037 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 4.5/100: 4% insanity sphere_of_insanity, voidform(22), insanity_drain_stacks(21)
1:25.055 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.5/100: 1% insanity sphere_of_insanity, voidform(23), insanity_drain_stacks(22)
1:26.067 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(23)
1:27.079 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(23)
1:28.090 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(23)
1:29.104 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity lingering_insanity(23)
1:30.116 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(23)
1:32.141 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity raid_movement, lingering_insanity(23), mind_sear_on_hit_reset
1:33.153 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity lingering_insanity(23), mind_sear_on_hit_reset
1:34.166 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity lingering_insanity(23)
1:34.166 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity sphere_of_insanity, voidform, lingering_insanity(23), insanity_drain_stacks
1:36.154 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.0/100: 95% insanity twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(23), insanity_drain_stacks(2), mind_sear_on_hit_reset
1:37.138 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(23), insanity_drain_stacks(3), mind_sear_on_hit_reset
1:39.064 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.1/100: 88% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(23), insanity_drain_stacks(5), mind_sear_on_hit_reset
1:40.020 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.0/100: 93% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(23), insanity_drain_stacks(6), mind_sear_on_hit_reset
1:40.976 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.7/100: 98% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(23), insanity_drain_stacks(7), mind_sear_on_hit_reset
1:41.924 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.3/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(23), insanity_drain_stacks(8), mind_sear_on_hit_reset
1:43.015 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.5/100: 87% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9)
1:45.544 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.0/100: 64% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12)
1:46.650 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.1/100: 68% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
1:47.752 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.6/100: 64% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14)
1:49.067 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.4/100: 42% insanity raid_movement, sphere_of_insanity, voidform(15), insanity_drain_stacks(15)
1:50.142 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.6/100: 42% insanity raid_movement, sphere_of_insanity, voidform(16), insanity_drain_stacks(16)
1:51.203 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.7/100: 31% insanity raid_movement, sphere_of_insanity, voidform(18), insanity_drain_stacks(18)
1:52.257 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 15.8/100: 16% insanity raid_movement, sphere_of_insanity, voidform(19), insanity_drain_stacks(19)
1:53.303 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.9/100: 13% insanity raid_movement, sphere_of_insanity, voidform(20), insanity_drain_stacks(20)
1:54.340 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.8/100: 1% insanity sphere_of_insanity, voidform(21), insanity_drain_stacks(21)
1:55.369 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(21)
1:56.399 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(21)
1:57.429 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(21)
1:58.458 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity lingering_insanity(21)
1:59.488 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 40.0/100: 40% insanity lingering_insanity(21)
2:00.518 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.0/100: 44% insanity lingering_insanity(21)
2:02.147 shadow_word_pain Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity lingering_insanity(21), mind_sear_on_hit_reset
2:03.178 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity lingering_insanity(21), mind_sear_on_hit_reset
2:03.178 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity sphere_of_insanity, voidform, lingering_insanity(21), insanity_drain_stacks, mind_sear_on_hit_reset
2:04.197 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.0/100: 69% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(21), insanity_drain_stacks(2), mind_sear_on_hit_reset
2:05.206 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.9/100: 67% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(21), insanity_drain_stacks(3)
2:06.205 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.9/100: 73% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(21), insanity_drain_stacks(4)
2:07.753 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.8/100: 84% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(21), insanity_drain_stacks(5), mind_sear_on_hit_reset
2:08.946 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.6/100: 87% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(21), insanity_drain_stacks(6), mind_sear_on_hit_reset
2:09.911 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.4/100: 93% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(21), insanity_drain_stacks(7), mind_sear_on_hit_reset
2:11.932 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
2:13.066 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.7/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mind_sear_on_hit_reset
2:14.201 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.7/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mind_sear_on_hit_reset
2:15.309 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.1/100: 69% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
2:16.409 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.6/100: 69% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14)
2:20.245 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 68.8/100: 69% insanity raid_movement, sphere_of_insanity, voidform(18), insanity_drain_stacks(15)
2:21.299 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(16)
2:22.347 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.0/100: 67% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(17)
2:22.566 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 63.6/100: 64% insanity power_infusion, sphere_of_insanity, voidform(20), insanity_drain_stacks(17)
2:23.398 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 54.1/100: 54% insanity power_infusion, sphere_of_insanity, voidform(21), insanity_drain_stacks(18)
2:24.223 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 60.5/100: 61% insanity power_infusion, sphere_of_insanity, voidform(22), insanity_drain_stacks(19)
2:25.040 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 50.2/100: 50% insanity power_infusion, sphere_of_insanity, voidform(22), insanity_drain_stacks(19)
2:25.857 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 40.8/100: 41% insanity power_infusion, sphere_of_insanity, voidform(23), insanity_drain_stacks(20)
2:26.664 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.9/100: 46% insanity power_infusion, sphere_of_insanity, voidform(24), insanity_drain_stacks(21)
2:27.470 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 45.7/100: 46% insanity power_infusion, sphere_of_insanity, voidform(25), insanity_drain_stacks(22)
2:28.270 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 35.4/100: 35% insanity power_infusion, sphere_of_insanity, voidform(26), insanity_drain_stacks(23), burning_intensity
2:29.060 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 39.4/100: 39% insanity power_infusion, sphere_of_insanity, voidform(26), insanity_drain_stacks(23), burning_intensity
2:29.853 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.4/100: 28% insanity power_infusion, sphere_of_insanity, voidform(27), insanity_drain_stacks(24), burning_intensity(2)
2:31.084 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.2/100: 46% insanity power_infusion, sphere_of_insanity, voidform(28), insanity_drain_stacks(25), mind_sear_on_hit_reset, burning_intensity(3)
2:31.858 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.5/100: 50% insanity power_infusion, sphere_of_insanity, voidform(29), insanity_drain_stacks(26), mind_sear_on_hit_reset, burning_intensity(4)
2:32.633 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.2/100: 48% insanity power_infusion, sphere_of_insanity, voidform(30), insanity_drain_stacks(27), mind_sear_on_hit_reset, burning_intensity(5)
2:33.826 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.4/100: 45% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(31), insanity_drain_stacks(28), mind_sear_on_hit_reset, burning_intensity(6)
2:34.582 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.3/100: 62% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(32), insanity_drain_stacks(29), mind_sear_on_hit_reset, burning_intensity(7)
2:35.854 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.1/100: 56% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(33), insanity_drain_stacks(30), mind_sear_on_hit_reset, burning_intensity(8)
2:36.003 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.6/100: 53% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(33), insanity_drain_stacks(30), mind_sear_on_hit_reset, burning_intensity(8)
2:36.828 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.6/100: 59% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(34), insanity_drain_stacks(31), mind_sear_on_hit_reset, burning_intensity(9)
2:37.579 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.1/100: 48% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(35), insanity_drain_stacks(32), mind_sear_on_hit_reset, burning_intensity(10)
2:38.330 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.9/100: 45% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(36), insanity_drain_stacks(33), mind_sear_on_hit_reset, burning_intensity(11)
2:39.084 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.1/100: 51% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(36), insanity_drain_stacks(33), mind_sear_on_hit_reset, burning_intensity(11)
2:40.389 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.5/100: 32% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(38), insanity_drain_stacks(35), mind_sear_on_hit_reset, burning_intensity(13)
2:41.259 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.4/100: 39% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(39), insanity_drain_stacks(36), mind_sear_on_hit_reset, burning_intensity(13)
2:42.013 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.9/100: 35% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(39), insanity_drain_stacks(36), mind_sear_on_hit_reset, burning_intensity(14)
2:42.809 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.0/100: 22% insanity twist_of_fate, sphere_of_insanity, voidform(40), insanity_drain_stacks(37), mind_sear_on_hit_reset, burning_intensity(15)
2:43.695 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.7/100: 18% insanity twist_of_fate, sphere_of_insanity, voidform(41), insanity_drain_stacks(38), mind_sear_on_hit_reset, burning_intensity(16)
2:45.676 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.0/100: 8% insanity twist_of_fate, lingering_insanity(42), burning_intensity(18)
2:46.553 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity twist_of_fate, lingering_insanity(42), burning_intensity(19)
2:50.797 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity raid_movement, lingering_insanity(42)
2:51.674 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.0/100: 49% insanity raid_movement, lingering_insanity(42)
2:52.553 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.0/100: 52% insanity raid_movement, lingering_insanity(42)
2:53.430 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.0/100: 55% insanity lingering_insanity(42)
2:54.306 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 67.0/100: 67% insanity lingering_insanity(42)
2:55.184 shadow_word_pain Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 71.0/100: 71% insanity lingering_insanity(42)
2:56.064 shadow_word_pain Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity lingering_insanity(42)
2:56.940 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity lingering_insanity(42)
2:56.940 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity sphere_of_insanity, voidform, lingering_insanity(42), insanity_drain_stacks
2:57.811 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 73.3/100: 73% insanity sphere_of_insanity, voidform, lingering_insanity(42), insanity_drain_stacks
2:58.681 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 69.7/100: 70% insanity sphere_of_insanity, voidform(2), lingering_insanity(42), insanity_drain_stacks(2)
2:59.534 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.4/100: 81% insanity sphere_of_insanity, voidform(3), lingering_insanity(42), insanity_drain_stacks(3)
3:00.387 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.9/100: 85% insanity sphere_of_insanity, voidform(4), lingering_insanity(42), insanity_drain_stacks(4)
3:01.813 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.9/100: 99% insanity sphere_of_insanity, voidform(5), lingering_insanity(42), insanity_drain_stacks(5), mind_sear_on_hit_reset
3:02.641 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.9/100: 97% insanity sphere_of_insanity, voidform(6), lingering_insanity(42), insanity_drain_stacks(6), mind_sear_on_hit_reset
3:03.990 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.0/100: 97% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(42), insanity_drain_stacks(8), mind_sear_on_hit_reset
3:04.803 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(42), insanity_drain_stacks(8), mind_sear_on_hit_reset
3:05.890 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.4/100: 86% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
3:08.000 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.4/100: 83% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mind_sear_on_hit_reset
3:09.235 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.3/100: 94% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mind_sear_on_hit_reset
3:10.336 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.8/100: 98% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mind_sear_on_hit_reset
3:11.429 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.8/100: 85% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15)
3:12.507 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.4/100: 86% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16)
3:14.827 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.7/100: 64% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(18)
3:15.875 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.9/100: 61% insanity twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(19)
3:16.922 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(20)
3:20.362 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 51.7/100: 52% insanity raid_movement, sphere_of_insanity, voidform(24), insanity_drain_stacks(20)
3:21.363 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.3/100: 53% insanity raid_movement, sphere_of_insanity, voidform(25), insanity_drain_stacks(21)
3:22.355 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.3/100: 37% insanity raid_movement, sphere_of_insanity, voidform(26), insanity_drain_stacks(22)
3:23.339 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 21.8/100: 22% insanity raid_movement, sphere_of_insanity, voidform(27), insanity_drain_stacks(23)
3:24.317 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.8/100: 18% insanity raid_movement, sphere_of_insanity, voidform(28), insanity_drain_stacks(24)
3:25.288 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.5/100: 1% insanity sphere_of_insanity, voidform(29), insanity_drain_stacks(25)
3:26.253 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(29)
3:27.218 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(29)
3:28.182 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity lingering_insanity(29)
3:29.147 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(29)
3:30.111 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity lingering_insanity(29)
3:32.286 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity lingering_insanity(29), mind_sear_on_hit_reset
3:32.286 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity sphere_of_insanity, voidform, lingering_insanity(29), insanity_drain_stacks, mind_sear_on_hit_reset
3:33.244 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.4/100: 75% insanity sphere_of_insanity, voidform, lingering_insanity(29), insanity_drain_stacks, mind_sear_on_hit_reset
3:34.747 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.4/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(29), insanity_drain_stacks(3), mind_sear_on_hit_reset
3:35.680 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.4/100: 94% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(29), insanity_drain_stacks(4), mind_sear_on_hit_reset
3:37.090 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.1/100: 97% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(29), insanity_drain_stacks(5), mind_sear_on_hit_reset
3:38.010 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.2/100: 99% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(29), insanity_drain_stacks(6), mind_sear_on_hit_reset
3:38.915 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.5/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(29), insanity_drain_stacks(7), mind_sear_on_hit_reset
3:40.244 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.3/100: 86% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(29), insanity_drain_stacks(8), mind_sear_on_hit_reset
3:41.370 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mind_sear_on_hit_reset
3:42.502 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.7/100: 84% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mind_sear_on_hit_reset
3:43.624 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.3/100: 84% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mind_sear_on_hit_reset
3:44.735 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.5/100: 76% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
3:45.833 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14)
3:48.321 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.4/100: 56% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(17)
3:49.384 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.6/100: 55% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(18)
3:50.438 shadowfiend Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.7/100: 36% insanity raid_movement, sphere_of_insanity, voidform(19), insanity_drain_stacks(19)
3:51.484 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 21.7/100: 22% insanity raid_movement, sphere_of_insanity, voidform(20), insanity_drain_stacks(20)
3:52.522 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.5/100: 23% insanity raid_movement, sphere_of_insanity, voidform(21), insanity_drain_stacks(21)
3:53.548 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.6/100: 6% insanity raid_movement, sphere_of_insanity, voidform(22), insanity_drain_stacks(22)
3:54.569 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity lingering_insanity(22)
3:55.589 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(22)
3:56.610 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity raid_movement, lingering_insanity(22)
3:57.631 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity lingering_insanity(22)
3:58.655 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 19.0/100: 19% insanity lingering_insanity(22)
3:59.676 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 27.0/100: 27% insanity lingering_insanity(22)
4:00.698 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.0/100: 31% insanity lingering_insanity(22)
4:02.346 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity lingering_insanity(22), mind_sear_on_hit_reset
4:03.368 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity lingering_insanity(22), mind_sear_on_hit_reset
4:03.368 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity sphere_of_insanity, voidform, lingering_insanity(22), insanity_drain_stacks, mind_sear_on_hit_reset
4:05.372 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.9/100: 78% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(22), insanity_drain_stacks(3), mind_sear_on_hit_reset
4:06.362 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.4/100: 84% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(22), insanity_drain_stacks(3), mind_sear_on_hit_reset
4:08.305 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(22), insanity_drain_stacks(5), mind_sear_on_hit_reset
4:09.268 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.6/100: 94% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(22), insanity_drain_stacks(6), mind_sear_on_hit_reset
4:10.232 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.7/100: 94% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(22), insanity_drain_stacks(7), mind_sear_on_hit_reset
4:11.186 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.3/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(22), insanity_drain_stacks(8), mind_sear_on_hit_reset
4:12.288 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.8/100: 86% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9)
4:13.420 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.8/100: 74% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11)
4:14.541 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.4/100: 66% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12)
4:15.650 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.7/100: 71% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13), burning_intensity
4:16.752 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.2/100: 66% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14), burning_intensity(2)
4:20.259 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 63.4/100: 63% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(14), burning_intensity(6)
4:21.313 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.7/100: 63% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(15), burning_intensity(7)
4:22.358 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.9/100: 49% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(16), burning_intensity(8)
4:22.566 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.5/100: 46% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(17), burning_intensity(8)
4:23.396 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 39.8/100: 40% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(18), burning_intensity(9)
4:24.220 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.4/100: 45% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(18), burning_intensity(9)
4:25.045 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 46.1/100: 46% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(19), burning_intensity(10)
4:25.863 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 46.7/100: 47% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(20), burning_intensity(11)
4:26.673 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(21), burning_intensity(12)
4:27.478 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 40.8/100: 41% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(22), burning_intensity(13)
4:28.278 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 25.6/100: 26% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(22), burning_intensity(14)
4:29.071 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.7/100: 30% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(23), burning_intensity(14)
4:29.858 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.4/100: 18% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(24), burning_intensity(15)
4:30.644 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.1/100: 17% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(25), burning_intensity(16)
4:31.424 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.3/100: 20% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(29), insanity_drain_stacks(26), burning_intensity(17)
4:32.719 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.4/100: 31% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(30), insanity_drain_stacks(27), mind_sear_on_hit_reset, burning_intensity(18)
4:33.716 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.5/100: 30% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(31), insanity_drain_stacks(28), mind_sear_on_hit_reset, burning_intensity(19)
4:34.478 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.7/100: 28% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(32), insanity_drain_stacks(29), mind_sear_on_hit_reset, burning_intensity(20)
4:35.791 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.3/100: 30% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(33), insanity_drain_stacks(30), mind_sear_on_hit_reset, burning_intensity
4:36.542 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.9/100: 33% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(34), insanity_drain_stacks(31), mind_sear_on_hit_reset, burning_intensity(2)
4:37.750 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.6/100: 32% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(35), insanity_drain_stacks(32), mind_sear_on_hit_reset, burning_intensity(3)
4:38.503 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.4/100: 33% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(36), insanity_drain_stacks(33), mind_sear_on_hit_reset, burning_intensity(4)
4:39.258 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.7/100: 45% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(36), insanity_drain_stacks(33), mind_sear_on_hit_reset, burning_intensity(5)
4:40.501 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.4/100: 36% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(38), insanity_drain_stacks(35), mind_sear_on_hit_reset, burning_intensity(6)
4:41.432 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.7/100: 32% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(39), insanity_drain_stacks(36), mind_sear_on_hit_reset, burning_intensity(7)
4:42.188 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.2/100: 27% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(39), insanity_drain_stacks(36), mind_sear_on_hit_reset, burning_intensity(7)
4:43.030 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.9/100: 13% insanity twist_of_fate, sphere_of_insanity, voidform(40), insanity_drain_stacks(37), mind_sear_on_hit_reset, burning_intensity(8)
4:43.915 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.0/100: 10% insanity twist_of_fate, sphere_of_insanity, voidform(41), insanity_drain_stacks(38), mind_sear_on_hit_reset, burning_intensity(9)
4:45.097 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity raid_movement, twist_of_fate, lingering_insanity(42), burning_intensity(10)
4:45.973 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.0/100: 11% insanity twist_of_fate, lingering_insanity(42), burning_intensity(11)
4:46.850 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.0/100: 27% insanity twist_of_fate, lingering_insanity(42), burning_intensity(12)
4:50.963 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.0/100: 41% insanity raid_movement, twist_of_fate, lingering_insanity(42), burning_intensity(16)
4:51.842 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity raid_movement, twist_of_fate, lingering_insanity(42), burning_intensity(17)
4:52.720 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.0/100: 55% insanity raid_movement, twist_of_fate, lingering_insanity(42), burning_intensity(18)
4:53.597 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity twist_of_fate, lingering_insanity(42), burning_intensity(19)
4:54.475 shadow_word_pain Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity twist_of_fate, lingering_insanity(42), burning_intensity(20)
4:55.354 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity twist_of_fate, lingering_insanity(42)
4:55.354 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(42), insanity_drain_stacks
4:56.223 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 73.3/100: 73% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(42), insanity_drain_stacks
4:57.093 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 73.7/100: 74% insanity twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(42), insanity_drain_stacks(2), burning_intensity
4:57.950 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 81.4/100: 81% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(42), insanity_drain_stacks(3), burning_intensity(2)
4:58.803 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 76.9/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(42), insanity_drain_stacks(4), burning_intensity(3)
4:59.648 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 72.1/100: 72% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(42), insanity_drain_stacks(5), burning_intensity(3)
5:00.482 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.8/100: 83% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(42), insanity_drain_stacks(6), burning_intensity(4)
5:01.310 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.5/100: 76% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(42), insanity_drain_stacks(6), burning_intensity(5)
5:02.138 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.9/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(42), insanity_drain_stacks(7), burning_intensity(6)
5:02.953 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.3/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(42), insanity_drain_stacks(8), burning_intensity(7)
5:04.840 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mind_sear_on_hit_reset, burning_intensity(9)
5:06.177 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.2/100: 88% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mind_sear_on_hit_reset, burning_intensity(10)
5:07.298 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.8/100: 93% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), burning_intensity(11)
5:08.934 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.5/100: 96% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mind_sear_on_hit_reset, burning_intensity(13)
5:10.023 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.8/100: 87% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15), mind_sear_on_hit_reset, burning_intensity(14)
5:12.444 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.3/100: 59% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(18), burning_intensity(16)
5:13.499 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.3/100: 65% insanity twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(19), burning_intensity(17)
5:14.548 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.4/100: 62% insanity twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(20), burning_intensity(18)
5:15.586 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.3/100: 51% insanity twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(21), burning_intensity(19)
5:16.612 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.3/100: 47% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(22), burning_intensity(20)
5:17.631 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.0/100: 39% insanity twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(23)
5:21.973 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(23)
5:22.950 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.0/100: 37% insanity twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(24)
5:23.925 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.4/100: 28% insanity twist_of_fate, sphere_of_insanity, voidform(29), insanity_drain_stacks(25)
5:24.884 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.5/100: 18% insanity twist_of_fate, sphere_of_insanity, voidform(30), insanity_drain_stacks(26)
5:25.839 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.0/100: 14% insanity twist_of_fate, sphere_of_insanity, voidform(31), insanity_drain_stacks(27)
5:26.786 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.1/100: 7% insanity twist_of_fate, sphere_of_insanity, voidform(32), insanity_drain_stacks(28)
5:27.731 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity twist_of_fate, lingering_insanity(32)
5:28.675 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity twist_of_fate, lingering_insanity(32)
5:33.189 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity twist_of_fate, lingering_insanity(32)
5:34.414 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity twist_of_fate, lingering_insanity(32), burning_intensity(2)
5:35.359 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity twist_of_fate, lingering_insanity(32), burning_intensity(3)
5:38.345 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity twist_of_fate, lingering_insanity(32), burning_intensity(6)
5:38.345 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(32), insanity_drain_stacks, burning_intensity(6)
5:40.399 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.4/100: 63% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(32), insanity_drain_stacks(3), burning_intensity(8)
5:41.315 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.4/100: 74% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(32), insanity_drain_stacks(3), burning_intensity(8)
5:42.230 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.4/100: 81% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(32), insanity_drain_stacks(4), burning_intensity(9)
5:43.131 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.6/100: 82% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(32), insanity_drain_stacks(5), burning_intensity(10)
5:44.023 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.7/100: 88% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(32), insanity_drain_stacks(6), burning_intensity(11)
5:46.010 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.1/100: 76% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(32), insanity_drain_stacks(8), burning_intensity(13)
5:47.048 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.7/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), burning_intensity(14)
5:48.183 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.4/100: 72% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), burning_intensity(15)
5:49.307 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.4/100: 59% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), burning_intensity(16)
5:50.419 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.9/100: 60% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13), burning_intensity(18)
5:52.899 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.8/100: 34% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15), burning_intensity(20)
5:53.976 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.0/100: 33% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16)
5:55.048 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.7/100: 27% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(17)
5:56.106 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.8/100: 23% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(18)
5:57.155 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.1/100: 20% insanity twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(19)
5:59.488 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity twist_of_fate, lingering_insanity(21), burning_intensity(2)
5:59.488 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity twist_of_fate, lingering_insanity(21), burning_intensity(2), potion_of_deadly_grace
6:00.518 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity twist_of_fate, lingering_insanity(21), burning_intensity(3), potion_of_deadly_grace
6:04.328 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity raid_movement, twist_of_fate, lingering_insanity(21), burning_intensity(6), potion_of_deadly_grace
6:05.355 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.0/100: 56% insanity twist_of_fate, lingering_insanity(21), burning_intensity(7), potion_of_deadly_grace
6:07.193 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity twist_of_fate, lingering_insanity(21), burning_intensity(9), potion_of_deadly_grace
6:08.223 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity twist_of_fate, lingering_insanity(21), burning_intensity(10), potion_of_deadly_grace
6:08.223 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(21), insanity_drain_stacks, burning_intensity(10), potion_of_deadly_grace
6:10.455 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.9/100: 78% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(21), insanity_drain_stacks(3), burning_intensity(13), potion_of_deadly_grace
6:11.453 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.9/100: 84% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(21), insanity_drain_stacks(4), burning_intensity(14), potion_of_deadly_grace
6:13.756 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.4/100: 67% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(21), insanity_drain_stacks(6), burning_intensity(16), potion_of_deadly_grace
6:14.722 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.5/100: 72% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(21), insanity_drain_stacks(7), burning_intensity(17), potion_of_deadly_grace
6:15.685 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.5/100: 76% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(21), insanity_drain_stacks(8), burning_intensity(18), potion_of_deadly_grace
6:16.718 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), burning_intensity(19), potion_of_deadly_grace
6:17.854 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), burning_intensity(20), potion_of_deadly_grace
6:20.320 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.0/100: 87% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(11), burning_intensity(2), potion_of_deadly_grace
6:21.420 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.1/100: 88% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(12), burning_intensity(3), potion_of_deadly_grace
6:22.513 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.4/100: 84% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(13), burning_intensity(4), potion_of_deadly_grace
6:22.566 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.6/100: 84% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(13), burning_intensity(4), potion_of_deadly_grace
6:23.433 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.1/100: 75% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(14), burning_intensity(5), potion_of_deadly_grace
6:24.293 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.3/100: 82% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(15), burning_intensity(6), potion_of_deadly_grace
6:26.158 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.7/100: 63% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(16), burning_intensity(8)
6:26.996 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.3/100: 68% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(17), burning_intensity(9)
6:27.835 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.9/100: 69% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(18), burning_intensity(10)
6:28.662 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.3/100: 67% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(19), burning_intensity(11)
6:29.484 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(20), burning_intensity(11)
6:31.459 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.6/100: 61% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(22), burning_intensity(13)
6:32.262 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.4/100: 65% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(23), burning_intensity(14)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6253 5928 0
Agility 7827 7502 0
Stamina 33689 33689 20910
Intellect 33276 31570 22741 (801)
Spirit 5 5 0
Health 2021340 2021340 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 33276 31570 0
Crit 30.47% 30.47% 8916
Haste 20.89% 19.74% 6414
Damage / Heal Versatility 0.73% 0.73% 290
ManaReg per Second 8800 8800 0
Mastery 39.08% 39.08% 2671
Armor 1630 1630 1630
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 858.00
Local Head Night Dreamer Crest
ilevel: 850, stats: { 211 Armor, +1297 Int, +1945 Sta, +904 Haste, +400 Mastery }
Local Neck Chain of the Underking
ilevel: 870, stats: { +1319 Sta, +1188 Crit, +791 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Shoulderpads of Crashing Waves
ilevel: 855, stats: { 199 Armor, +1019 Int, +1529 Sta, +627 Mastery, +370 Crit }
Local Chest Fluxflow Robes
ilevel: 850, stats: { 260 Armor, +1297 Int, +1945 Sta, +876 Haste, +428 Crit, +559 Avoidance }
Local Waist Roggthread Cord
ilevel: 860, stats: { 152 Armor, +1068 Int, +1601 Sta, +726 Haste, +290 Vers }
Local Legs Terrorweave Leggings
ilevel: 845, stats: { 224 Armor, +1238 Int, +1857 Sta, +805 Crit, +476 Haste }
Local Feet Cozy Dryad Hoof-Socks
ilevel: 850, stats: { 179 Armor, +1459 Sta, +973 Int, +658 Haste, +322 Crit }
Local Wrists Sunfrost Wristwraps
ilevel: 840, stats: { 110 Armor, +665 Int, +997 Sta, +490 Haste, +217 Crit, +379 unknown }
Local Hands Bonespeaker Gloves
ilevel: 845, stats: { 160 Armor, +929 Int, +1393 Sta, +645 Crit, +315 Mastery }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +150 Haste }
Local Finger2 Sephuz's Secret
ilevel: 895, stats: { +1665 Sta, +620 Haste, +1552 Crit }, gems: { +150 Haste }, enchant: { +150 Haste }
Local Trinket1 Nightborne Researcher's Phial
ilevel: 835, stats: { +1073 Int, +882 Crit }, gems: { +200 Int }
Local Trinket2 Infernal Writ
ilevel: 840, stats: { +1123 Int }
Local Back Giant's Handkerchief
ilevel: 860, stats: { 135 Armor, +1201 Sta, +801 StrAgiInt, +528 Crit, +233 Mastery }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 880, weapon: { 1508 - 2803, 1.8 }, stats: { +735 Int, +1103 Sta, +318 Crit, +305 Mastery, +9358 Int }, relics: { +45 ilevels, +43 ilevels, +42 ilevels }
Local Off Hand Secrets of the Void
ilevel: 880, stats: { +965 Int, +1448 Sta, +569 Haste, +252 Crit }
Local Tabard Renowned Guild Tabard
ilevel: 1

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Void Lord (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Shadow Crash (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Mind Spike (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Faelik"
origin="https://us.api.battle.net/wow/character/thrall/Faelik/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/187/153787323-avatar.jpg"
level=110
race=undead
role=spell
position=back
professions=alchemy=575/herbalism=800
talents=1211211
artifact=47:0:0:0:0:764:1:765:1:766:1:767:3:769:1:770:1:771:3:772:3:773:3:775:3:776:3:777:3:1347:1
spec=shadow

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
actions+=/variable,op=set,name=actors_fight_time_mod,value=0
actions+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions+=/variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions+=/variable,op=min,name=s2mcheck,value=180
actions+=/call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/call_action_list,name=vf,if=buff.voidform.up
actions+=/call_action_list,name=main

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
actions.main+=/shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
actions.main+=/shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
actions.main+=/mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_sear,if=active_enemies>=3,interrupt=1,chain=1
actions.main+=/mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
actions.main+=/mind_spike,if=talent.mind_spike.enabled
actions.main+=/shadow_word_pain

actions.s2m=shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
actions.s2m+=/power_infusion,if=buff.insanity_drain_stacks.stack>=85
actions.s2m+=/berserking,if=buff.voidform.stack>=90
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt
actions.s2m+=/void_torrent
actions.s2m+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.s2m+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.s2m+=/mind_blast
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.s2m+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
actions.s2m+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.s2m+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.s2m+=/mind_spike,if=talent.mind_spike.enabled

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
actions.vf+=/berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt
actions.vf+=/void_torrent,if=!talent.surrender_to_madness.enabled
actions.vf+=/void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
actions.vf+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
actions.vf+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.vf+=/mind_blast
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.vf+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.vf+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.vf+=/mind_spike,if=talent.mind_spike.enabled
actions.vf+=/shadow_word_pain

head=night_dreamer_crest,id=139086,bonus_id=3432/1512/3337
neck=chain_of_the_underking,id=134495,bonus_id=3414/1522/3337,enchant=mark_of_the_hidden_satyr
shoulders=shoulderpads_of_crashing_waves,id=137360,bonus_id=3411/1507/3336
back=giants_handkerchief,id=141538,bonus_id=1808/3466/1472
chest=fluxflow_robes,id=134413,bonus_id=3410/40/1502/3336
tabard=renowned_guild_tabard,id=69210
wrists=sunfrost_wristwraps,id=139130,bonus_id=1727/43/1502/1813
hands=bonespeaker_gloves,id=134217,bonus_id=3474/1507/1674
waist=roggthread_cord,id=134171,bonus_id=3410/1522/3337
legs=terrorweave_leggings,id=121326,bonus_id=3474/1507/1674
feet=cozy_dryad_hoofsocks,id=139194,bonus_id=1807/1472
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1805/1502/3337,enchant=150haste
finger2=sephuzs_secret,id=132452,bonus_id=1811,gems=150haste,enchant=150haste
trinket1=nightborne_researchers_phial,id=134292,bonus_id=3432/1808/603/1497/1674,gems=200int
trinket2=infernal_writ,id=137485,bonus_id=1727/1492/1813
main_hand=xalatath_blade_of_the_black_empire,id=128827,bonus_id=740,gem_id=141273/139254/137347/0,relic_id=3474:1517:3336/1807:1472/3411:1497:1813/0
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=858.44
# gear_stamina=20910
# gear_intellect=22741
# gear_crit_rating=8916
# gear_haste_rating=6414
# gear_mastery_rating=2671
# gear_versatility_rating=290
# gear_avoidance_rating=559
# gear_armor=1630

Raji

Raji : 359426 dps, 248606 dps to main target

  • Race: Troll
  • Class: Priest
  • Spec: Shadow
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
359425.6 359425.6 297.5 / 0.083% 57993.0 / 16.1% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.65% 48.2 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Raji/advanced
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Mind Bomb (Shadow Priest)
  • 60: Reaper of Souls (Shadow Priest)
  • 75: Auspicious Spirits (Shadow Priest)
  • 90: Mindbender (Shadow Priest)
  • 100: Legacy of the Void (Shadow Priest)
  • Talent Calculator
Artifact
Professions
  • tailoring: 762
  • enchanting: 715
Scale Factors for Raji Damage Per Second
Int Haste Crit Vers Mastery
Scale Factors 10.78 9.53 9.25 8.69 8.16
Normalized 1.00 0.88 0.86 0.81 0.76
Scale Deltas 1138 1138 1138 1138 1138
Error 0.38 0.38 0.38 0.38 0.38
Gear Ranking
Optimizers
Ranking
  • Int > Haste ~= Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=10.78, CritRating=9.25, HasteRating=9.53, MasteryRating=8.16, Versatility=8.69 )

Scale Factors for other metrics

Scale Factors for Raji Damage Per Second
Int Haste Crit Vers Mastery
Scale Factors 10.78 9.53 9.25 8.69 8.16
Normalized 1.00 0.88 0.86 0.81 0.76
Scale Deltas 1138 1138 1138 1138 1138
Error 0.38 0.38 0.38 0.38 0.38
Gear Ranking
Optimizers
Ranking
  • Int > Haste ~= Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=10.78, CritRating=9.25, HasteRating=9.53, MasteryRating=8.16, Versatility=8.69 )
Scale Factors for Raji Priority Target Damage Per Second
Int Crit Haste Vers Mastery
Scale Factors 7.72 7.29 7.05 6.02 5.61
Normalized 1.00 0.94 0.91 0.78 0.73
Scale Deltas 1138 1138 1138 1138 1138
Error 0.13 0.13 0.13 0.13 0.13
Gear Ranking
Optimizers
Ranking
  • Int > Crit > Haste > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=7.72, CritRating=7.29, HasteRating=7.05, MasteryRating=5.61, Versatility=6.02 )
Scale Factors for Raji Damage Per Second (Effective)
Int Haste Crit Vers Mastery
Scale Factors 10.78 9.53 9.25 8.69 8.16
Normalized 1.00 0.88 0.86 0.81 0.76
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Int > Haste > Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=10.78, CritRating=9.25, HasteRating=9.53, MasteryRating=8.16, Versatility=8.69 )
Scale Factors for Raji Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for RajiTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Raji 359426
Deadly Grace 9438 2.6% 28.7 14.46sec 130135 0 Direct 28.6 98070 196203 130233 32.8%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.66 28.64 0.00 0.00 0.0000 0.0000 3730012.95 3730012.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.25 67.22% 98070.45 89490 107388 98060.75 91374 104032 1888214 1888214 0.00
crit 9.39 32.78% 196202.61 178979 214775 196192.55 178979 214775 1841799 1841799 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mind Blast 22688 6.3% 48.4 8.20sec 187678 169964 Direct 49.4 138569 277040 183879 32.7%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.41 49.41 0.00 0.00 1.1042 0.0000 9086084.90 9086084.90 0.00 169963.62 169963.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.24 67.28% 138568.94 102724 160249 138579.39 126399 149463 4606579 4606579 0.00
crit 16.17 32.72% 277040.02 205448 320499 277081.07 236493 315216 4479506 4479506 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=12} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 13229 3.8% 47.7 8.44sec 113183 71843 Periodic 126.2 32257 64490 42788 32.7% 16.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.71 0.00 126.19 126.19 1.5754 0.5171 5399479.89 5399479.89 0.00 71842.67 71842.67
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.0 67.33% 32257.19 23481 36631 32189.22 29137 34325 2740585 2740585 0.00
crit 41.2 32.67% 64490.20 46962 73261 64367.50 57153 70614 2658894 2658894 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.mind_spike.enabled
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}$?s120585[. Each time Mind Flay deals damage, the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]$?a185916[ |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.550000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Mind Sear 39022 10.8% 28.1 10.19sec 549878 312222 Periodic 404.8 28745 57498 38149 32.7% 10.4%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.08 0.00 70.98 404.76 1.7612 0.5897 15441554.56 15441554.56 0.00 312221.82 312221.82
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 272.4 67.29% 28744.66 22092 34464 28767.36 26763 31121 7829264 7829264 0.00
crit 132.4 32.71% 57498.11 44185 68928 57544.76 52946 63137 7612291 7612291 0.00
 
 

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing Shadow damage to all targets within $49821a2 yards.
  • description:Corrosive shadow energy radiates from the target, dealing ${$49821m2*6} Shadow damage over {$48045d=5 seconds} to all enemies within $49821a2 yards of the target. |cFFFFFFFFGenerates ${$208232m1*6/100} Insanity over the duration per target hit.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a2 yards.
  • description:{$@spelldesc48045=Corrosive shadow energy radiates from the target, dealing ${$49821m2*6} Shadow damage over {$48045d=5 seconds} to all enemies within $49821a2 yards of the target. |cFFFFFFFFGenerates ${$208232m1*6/100} Insanity over the duration per target hit.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.540000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Shadow Word: Death 8527 2.4% 14.1 10.16sec 240837 225430 Direct 14.1 181470 363070 240834 32.7%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.12 14.12 0.00 0.00 1.0684 0.0000 3400618.18 3400618.18 0.00 225430.44 225430.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.50 67.31% 181469.84 119090 185780 181514.91 153229 185780 1724696 1724696 0.00
crit 4.62 32.69% 363069.75 238180 371560 361610.17 0 371560 1675923 1675923 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=10} Insanity, or $/100;190714s1 if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.250000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 43752 12.2% 41.5 9.42sec 421670 415024 Direct 41.5 33910 67829 45010 32.7%  
Periodic 296.5 39718 79431 52692 32.7% 103.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.48 41.48 296.48 296.48 1.0160 1.3931 17489093.69 17489093.69 0.00 38422.96 415023.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.90 67.27% 33909.83 26348 41103 33919.91 30612 37473 946148 946148 0.00
crit 13.57 32.73% 67829.24 52697 82207 67850.08 58406 79162 920697 920697 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 199.6 67.33% 39717.98 28 45113 39726.00 38505 40866 7928464 7928464 0.00
crit 96.9 32.67% 79431.10 447 90227 79431.63 75473 83523 7693784 7693784 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<(3+(4%3))*gcd
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=14 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.410000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.450000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Shadowy Apparitions 14725 4.1% 167.2 2.36sec 35161 0 Direct 165.8 26727 53441 35469 32.7%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 167.21 165.76 0.00 0.00 0.0000 0.0000 5879312.06 5879312.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.52 67.28% 26727.10 19566 30524 26730.95 25265 28285 2980529 2980529 0.00
crit 54.24 32.72% 53441.21 39133 61047 53449.59 49307 57444 2898783 2898783 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.275000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Vampiric Touch 79926 22.2% 33.8 9.06sec 942561 881620 Periodic 358.3 66949 133947 88865 32.7% 187.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.78 0.00 358.27 358.27 1.0691 2.0963 31837057.77 31837057.77 0.00 40445.57 881619.90
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 241.1 67.29% 66948.71 103 77183 66967.96 64570 69374 16139735 16139735 0.00
crit 117.2 32.71% 133947.46 401 154366 133980.63 126336 141017 15697322 15697322 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.vampiric_touch.remains<(4+(4%3))*gcd
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=18 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.790000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 49670 13.9% 81.3 4.79sec 244348 231041 Direct 81.1 184753 369471 245142 32.7%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.33 81.07 0.00 0.00 1.0576 0.0000 19873192.90 19873192.90 0.00 231040.65 231040.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.57 67.31% 184752.68 125253 195395 184744.49 179112 190646 10081024 10081024 0.00
crit 26.50 32.69% 369471.50 250506 390790 369450.15 347369 390790 9792169 9792169 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage$?a231688[ and refreshing Shadow Word: Pain and Vampiric Touch to their original duration][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 9979 2.8% 11.5 35.50sec 346805 0 Direct 50.3 59767 119542 79278 32.6%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.51 50.34 0.00 0.00 0.0000 0.0000 3990595.45 3990595.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.91 67.36% 59767.05 53364 64037 59773.26 54508 64037 2026536 2026536 0.00
crit 16.43 32.64% 119542.06 106728 128074 119547.17 106728 128074 1964059 1964059 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 15284 4.3% 6.9 61.27sec 883910 239165 Periodic 42.5 108491 217261 144027 32.7% 5.9%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.92 0.00 42.47 42.47 3.6958 0.5547 6117358.22 6117358.22 0.00 239164.84 239164.84
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.6 67.33% 108491.13 623 122096 108474.43 92279 121025 3102568 3102568 0.00
crit 13.9 32.67% 217260.75 1246 244193 217241.40 147211 244193 3014790 3014790 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.200000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Volatile Ichor 31579 8.7% 21.9 17.95sec 570036 0 Direct 74.1 127341 254615 168863 32.6%  

Stats details: volatile_ichor

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.94 74.06 0.00 0.00 0.0000 0.0000 12505225.11 12505225.11 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.90 67.38% 127340.61 117119 140543 127444.67 117941 139833 6353666 6353666 0.00
crit 24.16 32.62% 254615.01 234238 281085 254852.67 234238 281085 6151559 6151559 0.00
 
 

Action details: volatile_ichor

Static Values
  • id:222187
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222187
  • name:Volatile Ichor
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a Volatile Ichor, which creeps towards the target and explodes on contact, dealing {$s1=65033} Nature damage within $222197A1 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:103616.84
  • base_dd_max:103616.84
 
pet - mindbender 61693 / 16207
melee 61693 4.5% 91.0 4.27sec 71171 64402 Direct 91.0 53605 107211 71171 32.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.04 91.04 0.00 0.00 1.1051 0.0000 6479494.03 6479494.03 0.00 64402.09 64402.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.21 67.23% 53605.43 47561 54695 53604.61 52739 54491 3281197 3281197 0.00
crit 29.83 32.77% 107211.42 95121 109390 107212.03 103382 109390 3198297 3198297 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
pet - void_tendril 30189 / 4813
Mind Flay (_void_tendril) 30189 (33177) 1.4% (2.2%) 9.2 40.27sec 346627 68863 Periodic 46.3 31708 63416 42063 32.7% 11.6%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.20 0.00 46.33 46.33 5.0337 1.0000 1948919.97 1948919.97 0.00 68862.52 68862.52
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.2 67.34% 31708.14 31708 31708 31708.14 31708 31708 989374 989374 0.00
crit 15.1 32.66% 63416.28 63416 63416 63409.93 0 63416 959546 959546 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 30643 0.3% 2.0 58.70sec 208320 42029 Periodic 9.9 31708 63416 42028 32.5% 2.5%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 9.91 9.91 4.9567 1.0000 416293.19 416293.19 0.00 42028.59 42028.59
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.7 67.45% 31708.14 31708 31708 31561.53 0 31708 211853 211853 0.00
crit 3.2 32.55% 63416.28 63416 63416 59440.30 0 63416 204440 204440 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 31309 0.2% 1.4 6.42sec 214900 42081 Periodic 7.3 31708 63416 42081 32.7% 1.8%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.44 0.00 7.34 7.34 5.1069 1.0000 309004.15 309004.15 0.00 42081.46 42081.46
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.9 67.29% 31708.14 31708 31708 31374.37 0 31708 156672 156672 0.00
crit 2.4 32.71% 63416.28 63416 63416 57541.93 0 63416 152333 152333 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 32610 0.2% 1.3 4.32sec 241334 41372 Periodic 7.5 31708 63416 41372 30.5% 1.9%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.29 0.00 7.50 7.50 5.8333 1.0000 310286.78 310286.78 0.00 41371.57 41371.57
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.2 69.52% 31708.14 31708 31708 31708.14 31708 31708 165335 165335 0.00
crit 2.3 30.48% 63416.28 63416 63416 63416.28 63416 63416 144951 144951 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 30863 0.1% 1.0 0.00sec 206103 34350 Periodic 6.0 31708 63416 34350 8.3% 1.5%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 6.00 6.00 6.0000 1.0000 206102.90 206102.90 0.00 34350.48 34350.48
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.5 91.67% 31708.14 31708 31708 31708.14 31708 31708 174395 174395 0.00
crit 0.5 8.33% 63416.28 63416 63416 31708.14 0 63416 31708 31708 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Raji
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Raji
  • harmful:false
  • if_expr:
 
Berserking 2.6 186.10sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.voidform.stack>=90
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Raji
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Raji
  • harmful:false
  • if_expr:
 
Mindbender 7.1 60.47sec

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.11 0.00 0.00 0.00 1.1182 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: mindbender

Static Values
  • id:200174
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&!talent.surrender_to_madness.enabled
Spelldata
  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates {$s3=4} Insanity each time the Mindbender attacks.|r
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 
pet - mindbender
Shadowcrawl 21.1 18.92sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.08 0.00 0.00 0.00 1.1241 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.6 0.0 186.0sec 186.0sec 6.31% 8.11% 0.0(0.0) 2.5

Buff details

  • buff initial source:Raji
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 11.45% 0.0(0.0) 1.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
insanity_drain_stacks 11.5 269.3 35.5sec 35.5sec 74.44% 74.44% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:3.66%
  • insanity_drain_stacks_2:2.94%
  • insanity_drain_stacks_3:2.86%
  • insanity_drain_stacks_4:3.06%
  • insanity_drain_stacks_5:3.41%
  • insanity_drain_stacks_6:3.31%
  • insanity_drain_stacks_7:3.08%
  • insanity_drain_stacks_8:3.38%
  • insanity_drain_stacks_9:3.47%
  • insanity_drain_stacks_10:3.11%
  • insanity_drain_stacks_11:2.96%
  • insanity_drain_stacks_12:3.04%
  • insanity_drain_stacks_13:3.02%
  • insanity_drain_stacks_14:3.05%
  • insanity_drain_stacks_15:2.88%
  • insanity_drain_stacks_16:2.85%
  • insanity_drain_stacks_17:2.76%
  • insanity_drain_stacks_18:2.71%
  • insanity_drain_stacks_19:2.65%
  • insanity_drain_stacks_20:2.42%
  • insanity_drain_stacks_21:2.11%
  • insanity_drain_stacks_22:1.86%
  • insanity_drain_stacks_23:1.61%
  • insanity_drain_stacks_24:1.35%
  • insanity_drain_stacks_25:1.22%
  • insanity_drain_stacks_26:1.07%
  • insanity_drain_stacks_27:0.89%
  • insanity_drain_stacks_28:0.81%
  • insanity_drain_stacks_29:0.74%
  • insanity_drain_stacks_30:0.61%
  • insanity_drain_stacks_31:0.55%
  • insanity_drain_stacks_32:0.45%
  • insanity_drain_stacks_33:0.33%
  • insanity_drain_stacks_34:0.16%
  • insanity_drain_stacks_35:0.06%
  • insanity_drain_stacks_36:0.02%
  • insanity_drain_stacks_37:0.01%
  • insanity_drain_stacks_38:0.00%
  • insanity_drain_stacks_39:0.00%
  • insanity_drain_stacks_40:0.00%
  • insanity_drain_stacks_41:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Lingering Insanity 11.5 0.0 33.8sec 33.8sec 23.51% 23.51% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_13:0.00%
  • lingering_insanity_14:0.00%
  • lingering_insanity_15:0.00%
  • lingering_insanity_16:0.04%
  • lingering_insanity_17:0.24%
  • lingering_insanity_18:0.37%
  • lingering_insanity_19:1.39%
  • lingering_insanity_20:2.63%
  • lingering_insanity_21:1.50%
  • lingering_insanity_22:0.77%
  • lingering_insanity_23:0.39%
  • lingering_insanity_24:0.51%
  • lingering_insanity_25:0.81%
  • lingering_insanity_26:1.73%
  • lingering_insanity_27:1.64%
  • lingering_insanity_28:1.49%
  • lingering_insanity_29:1.34%
  • lingering_insanity_30:0.78%
  • lingering_insanity_31:0.53%
  • lingering_insanity_32:0.55%
  • lingering_insanity_33:0.59%
  • lingering_insanity_34:0.80%
  • lingering_insanity_35:0.94%
  • lingering_insanity_36:1.59%
  • lingering_insanity_37:1.55%
  • lingering_insanity_38:0.79%
  • lingering_insanity_39:0.32%
  • lingering_insanity_40:0.13%
  • lingering_insanity_41:0.05%
  • lingering_insanity_42:0.02%
  • lingering_insanity_43:0.01%
  • lingering_insanity_44:0.00%
  • lingering_insanity_45:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197937
  • name:Lingering Insanity
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc194249={$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}}
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
mind_sear_on_hit_reset 11.7 16.4 25.7sec 10.2sec 26.35% 26.35% 0.0(0.0) 11.5

Buff details

  • buff initial source:Raji
  • cooldown name:buff_mind_sear_on_hit_reset
  • max_stacks:2
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • mind_sear_on_hit_reset_1:26.35%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of Deadly Grace 2.0 0.0 363.8sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.52% 14.52% 2.0(2.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.52%

Trigger Attempt Success

  • trigger_pct:100.00%
Twist of Fate 8.5 407.5 29.5sec 0.9sec 63.03% 63.03% 407.5(407.5) 7.5

Buff details

  • buff initial source:Raji
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:63.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 6.9 0.0 61.3sec 61.3sec 6.05% 6.05% 0.0(0.0) 5.2

Buff details

  • buff initial source:Raji
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:6.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 11.5 0.0 35.5sec 35.5sec 74.44% 67.62% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_1:2.87%
  • voidform_2:2.86%
  • voidform_3:2.85%
  • voidform_4:2.85%
  • voidform_5:2.84%
  • voidform_6:2.83%
  • voidform_7:2.83%
  • voidform_8:2.82%
  • voidform_9:2.81%
  • voidform_10:2.81%
  • voidform_11:2.80%
  • voidform_12:2.79%
  • voidform_13:2.79%
  • voidform_14:2.78%
  • voidform_15:2.77%
  • voidform_16:2.76%
  • voidform_17:2.74%
  • voidform_18:2.70%
  • voidform_19:2.62%
  • voidform_20:2.38%
  • voidform_21:2.15%
  • voidform_22:2.04%
  • voidform_23:1.96%
  • voidform_24:1.89%
  • voidform_25:1.80%
  • voidform_26:1.58%
  • voidform_27:1.31%
  • voidform_28:1.09%
  • voidform_29:0.90%
  • voidform_30:0.77%
  • voidform_31:0.69%
  • voidform_32:0.63%
  • voidform_33:0.57%
  • voidform_34:0.51%
  • voidform_35:0.42%
  • voidform_36:0.33%
  • voidform_37:0.17%
  • voidform_38:0.08%
  • voidform_39:0.03%
  • voidform_40:0.01%
  • voidform_41:0.00%
  • voidform_42:0.00%
  • voidform_43:0.00%
  • voidform_44:0.00%
  • voidform_45:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
mindbender: raid_movement 0.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:0.00%

Trigger Attempt Success

  • trigger_pct:0.03%
mindbender: Shadowcrawl 21.1 0.0 18.9sec 18.9sec 86.69% 84.72% 0.0(0.0) 14.0

Buff details

  • buff initial source:Raji_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:86.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
void_tendril: raid_movement 4.0 0.0 68.4sec 68.4sec 19.41% 19.41% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:19.41%

Trigger Attempt Success

  • trigger_pct:100.00%
void_tendril: raid_movement 0.7 0.0 126.9sec 126.9sec 16.91% 16.91% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:16.92%

Trigger Attempt Success

  • trigger_pct:57.63%
void_tendril: raid_movement 0.4 0.0 180.0sec 180.0sec 14.80% 14.80% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:15.12%

Trigger Attempt Success

  • trigger_pct:41.89%
void_tendril: raid_movement 0.3 0.0 0.0sec 0.0sec 10.20% 10.20% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.28%

Trigger Attempt Success

  • trigger_pct:28.57%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Raji
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Raji
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Raji
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowform

Buff details

  • buff initial source:Raji
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Raji
Resource Gains Type Count Total Average Overflow
Insanity Gained from Auspicious Spirits Insanity 165.76 620.57 (1085.71%) 3.74 42.47 6.41%
Insanity Drained by Voidform Insanity 5959.33 -4382.47 (-7667.31%) -0.74 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 49.41 586.50 (1026.11%) 11.87 6.46 1.09%
Insanity Gained from Mind Flay Insanity 126.19 252.35 (441.50%) 2.00 0.03 0.01%
Insanity Gained from Mind Sear Insanity 404.76 591.03 (1034.02%) 1.46 16.12 2.66%
Insanity Gained from Mindbender Insanity 91.04 315.53 (552.03%) 3.47 48.64 13.36%
Insanity Gained from Shadow Word: Death Insanity 14.12 375.94 (657.72%) 26.62 47.67 11.25%
Insanity Gained from Shadow Word: Pain Casts Insanity 41.48 123.59 (216.22%) 2.98 0.84 0.68%
Insanity Gained from Vampiric Touch Casts Insanity 33.78 134.82 (235.88%) 3.99 0.28 0.21%
Insanity Gained from Void Bolt Insanity 81.33 1128.96 (1975.16%) 13.88 172.35 13.24%
Insanity Saved by Void Torrent Insanity 483.03 310.34 (542.96%) 0.64 0.00 0.00%
Health from Vampiric Touch Ticks Health 358.27 0.00 (0.00%) 0.00 15918564.13 100.00%
mp5_regen Mana 662.04 0.00 (0.00%) 0.00 3519923.79 100.00%
Resource RPS-Gain RPS-Loss
Insanity 11.08 10.94
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 57.37 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 167.2 2.4sec
Void Eruption casted when a target with both DoTs was up 12.4 35.5sec
Void Eruption casted when a target with no DoTs was up 13.9 56.3sec
Void Eruption casted when a target with only Shadow Word: Pain was up 0.5 207.8sec
Void Eruption casted when a target with only Vampiric Touch was up 25.7 32.8sec
Void Tendril spawned from Call to the Void 7.3 52.7sec

Statistics & Data Analysis

Fight Length
Sample Data Raji Fight Length
Count 9999
Mean 400.62
Minimum 307.54
Maximum 499.01
Spread ( max - min ) 191.47
Range [ ( max - min ) / 2 * 100% ] 23.90%
DPS
Sample Data Raji Damage Per Second
Count 9999
Mean 359425.55
Minimum 318938.26
Maximum 421261.03
Spread ( max - min ) 102322.78
Range [ ( max - min ) / 2 * 100% ] 14.23%
Standard Deviation 15176.8717
5th Percentile 337284.33
95th Percentile 386794.18
( 95th Percentile - 5th Percentile ) 49509.84
Mean Distribution
Standard Deviation 151.7763
95.00% Confidence Intervall ( 359128.08 - 359723.03 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 68
0.1% Error 6849
0.1 Scale Factor Error with Delta=300 1966292
0.05 Scale Factor Error with Delta=300 7865171
0.01 Scale Factor Error with Delta=300 196629283
Priority Target DPS
Sample Data Raji Priority Target Damage Per Second
Count 9999
Mean 248606.30
Minimum 230230.81
Maximum 268053.66
Spread ( max - min ) 37822.85
Range [ ( max - min ) / 2 * 100% ] 7.61%
Standard Deviation 5150.0571
5th Percentile 240050.79
95th Percentile 257158.49
( 95th Percentile - 5th Percentile ) 17107.69
Mean Distribution
Standard Deviation 51.5031
95.00% Confidence Intervall ( 248505.36 - 248707.24 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1648
0.1 Scale Factor Error with Delta=300 226416
0.05 Scale Factor Error with Delta=300 905665
0.01 Scale Factor Error with Delta=300 22641633
DPS(e)
Sample Data Raji Damage Per Second (Effective)
Count 9999
Mean 359425.55
Minimum 318938.26
Maximum 421261.03
Spread ( max - min ) 102322.78
Range [ ( max - min ) / 2 * 100% ] 14.23%
Damage
Sample Data Raji Damage
Count 9999
Mean 134749585.68
Minimum 107195357.64
Maximum 165096157.06
Spread ( max - min ) 57900799.42
Range [ ( max - min ) / 2 * 100% ] 21.48%
DTPS
Sample Data Raji Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Raji Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Raji Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Raji Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Raji Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Raji Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data RajiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Raji Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
0.00 variable,op=set,name=actors_fight_time_mod,value=0
0.00 variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
0.00 variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
0.00 variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
0.00 variable,op=min,name=s2mcheck,value=180
8 0.00 call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
9 0.00 call_action_list,name=vf,if=buff.voidform.up
A 0.00 call_action_list,name=main
actions.main
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
B 4.56 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
C 1.99 shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
D 1.25 vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
E 11.51 void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
F 1.39 shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
G 1.24 shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
H 12.36 mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
0.00 mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
I 19.35 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
J 8.17 mind_sear,if=active_enemies>=3,interrupt=1,chain=1
K 7.82 mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
0.00 mind_spike,if=talent.mind_spike.enabled
L 9.67 shadow_word_pain
actions.vf
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 shadow_crash,if=talent.shadow_crash.enabled
M 2.78 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
0.00 power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
0.00 power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
N 2.58 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
0.00 berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
O 21.65 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
P 1.98 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
Q 1.77 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
R 55.92 void_bolt
S 6.92 void_torrent,if=!talent.surrender_to_madness.enabled
0.00 void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
T 4.95 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
U 41.03 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
V 7.92 shadow_word_death,if=cooldown.shadow_word_death.charges=2
0.00 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
W 0.02 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
X 0.21 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
Y 15.49 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
Z 18.13 mind_sear,if=active_enemies>=3,interrupt=1
a 31.53 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
b 28.40 shadow_word_pain

Sample Sequence

012456BCDKHKESPbURaRNUaObbObUOYYObbOUZRZRUZRZRUaRabHKLLLHIIEYYOMURZRUZRSRbURabObUIIIIIJHLEZRZURaRUaRbaObbHIIIIIBHJEbZRZURSRUaOYYOUYOYYRUJEbZRUaRaRUaObbOUYIIIHBJEZPbURaRSNRbbOUbOYYOUIJEZURZbRUaRaRbbOUIILIIJBFEUZRZURbaRSOVbOUYOYbOUVRZRUTRZTRUKLKHLLLLIIHEYYOVZMQUZRVaRUaRbSRUVRaRUaRKGHKEaRUVRaRUaRVaRUa7RaRGBLHKEaRUVRaNRbSRUVRaR

Sample Sequence Table

time name target resources buffs
Pre flask Raji 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre food Raji 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre augmentation Raji 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
Pre shadowform Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.000 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:01.211 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity bloodlust, potion_of_deadly_grace
0:02.192 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.0/100: 23% insanity bloodlust, potion_of_deadly_grace
0:03.174 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.0/100: 31% insanity bloodlust, potion_of_deadly_grace
0:06.370 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity bloodlust, potion_of_deadly_grace
0:07.352 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity bloodlust, potion_of_deadly_grace
0:08.976 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity bloodlust, potion_of_deadly_grace
0:08.976 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity bloodlust, voidform, insanity_drain_stacks, potion_of_deadly_grace
0:12.112 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.1/100: 99% insanity bloodlust, raid_movement, voidform(4), insanity_drain_stacks, potion_of_deadly_grace
0:13.054 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.3/100: 96% insanity bloodlust, raid_movement, voidform(5), insanity_drain_stacks(2), potion_of_deadly_grace
0:13.989 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.7/100: 95% insanity bloodlust, voidform(6), insanity_drain_stacks(3), potion_of_deadly_grace
0:14.914 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity bloodlust, voidform(6), insanity_drain_stacks(3), potion_of_deadly_grace
0:15.831 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.5/100: 91% insanity bloodlust, voidform(7), insanity_drain_stacks(4), potion_of_deadly_grace
0:17.962 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.5/100: 76% insanity bloodlust, voidform(9), insanity_drain_stacks(6), potion_of_deadly_grace
0:18.856 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.7/100: 85% insanity bloodlust, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace
0:18.856 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.7/100: 85% insanity bloodlust, berserking, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace
0:19.632 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.1/100: 91% insanity bloodlust, berserking, voidform(11), insanity_drain_stacks(8), potion_of_deadly_grace
0:20.528 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 79.7/100: 80% insanity bloodlust, berserking, raid_movement, voidform(12), insanity_drain_stacks(9), potion_of_deadly_grace
0:21.287 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity bloodlust, berserking, raid_movement, voidform(13), insanity_drain_stacks(10), potion_of_deadly_grace
0:22.043 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.1/100: 79% insanity bloodlust, berserking, raid_movement, voidform(14), insanity_drain_stacks(11), potion_of_deadly_grace
0:22.799 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 71.6/100: 72% insanity bloodlust, berserking, raid_movement, voidform(14), insanity_drain_stacks(11), potion_of_deadly_grace
0:23.547 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.1/100: 85% insanity bloodlust, berserking, raid_movement, voidform(15), insanity_drain_stacks(12)
0:24.298 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.2/100: 77% insanity bloodlust, berserking, voidform(16), insanity_drain_stacks(13)
0:25.050 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity bloodlust, berserking, voidform(17), insanity_drain_stacks(14)
0:25.806 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 82.7/100: 83% insanity bloodlust, berserking, voidform(17), insanity_drain_stacks(14)
0:26.555 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 78.9/100: 79% insanity bloodlust, berserking, voidform(18), insanity_drain_stacks(15)
0:27.309 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 70.9/100: 71% insanity bloodlust, berserking, voidform(19), insanity_drain_stacks(16)
0:28.061 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.8/100: 83% insanity bloodlust, berserking, raid_movement, voidform(20), insanity_drain_stacks(17)
0:28.815 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.1/100: 73% insanity bloodlust, berserking, raid_movement, voidform(20), insanity_drain_stacks(17)
0:29.671 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 61.6/100: 62% insanity bloodlust, voidform(21), insanity_drain_stacks(18)
0:30.477 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.6/100: 63% insanity bloodlust, voidform(22), insanity_drain_stacks(19)
0:31.284 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.2/100: 60% insanity bloodlust, voidform(23), insanity_drain_stacks(20)
0:32.580 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.2/100: 71% insanity bloodlust, voidform(24), insanity_drain_stacks(21), mind_sear_on_hit_reset
0:33.368 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.9/100: 81% insanity bloodlust, voidform(25), insanity_drain_stacks(22), mind_sear_on_hit_reset
0:34.761 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.5/100: 72% insanity bloodlust, twist_of_fate, voidform(26), insanity_drain_stacks(23), mind_sear_on_hit_reset
0:35.694 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.5/100: 69% insanity bloodlust, twist_of_fate, voidform(27), insanity_drain_stacks(24), mind_sear_on_hit_reset
0:36.468 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.0/100: 69% insanity bloodlust, twist_of_fate, voidform(28), insanity_drain_stacks(25), mind_sear_on_hit_reset
0:37.753 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.7/100: 64% insanity bloodlust, twist_of_fate, voidform(29), insanity_drain_stacks(26), mind_sear_on_hit_reset
0:38.509 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.4/100: 63% insanity bloodlust, twist_of_fate, voidform(30), insanity_drain_stacks(27), mind_sear_on_hit_reset
0:39.783 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.8/100: 65% insanity bloodlust, twist_of_fate, voidform(31), insanity_drain_stacks(28), mind_sear_on_hit_reset
0:40.759 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.1/100: 59% insanity bloodlust, twist_of_fate, voidform(32), insanity_drain_stacks(29), mind_sear_on_hit_reset
0:41.660 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.4/100: 54% insanity twist_of_fate, voidform(33), insanity_drain_stacks(30), mind_sear_on_hit_reset
0:42.619 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.9/100: 40% insanity twist_of_fate, voidform(34), insanity_drain_stacks(31), mind_sear_on_hit_reset
0:43.568 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.1/100: 33% insanity twist_of_fate, voidform(35), insanity_drain_stacks(32)
0:44.709 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.8/100: 9% insanity raid_movement, twist_of_fate, voidform(36), insanity_drain_stacks(33)
0:45.641 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity twist_of_fate, lingering_insanity(37)
0:46.572 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(37)
0:50.890 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity raid_movement, lingering_insanity(37)
0:51.821 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.0/100: 37% insanity raid_movement, lingering_insanity(37)
0:52.754 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.0/100: 40% insanity raid_movement, lingering_insanity(37)
0:53.684 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.0/100: 43% insanity lingering_insanity(37)
0:54.617 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity lingering_insanity(37)
0:55.548 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 63.0/100: 63% insanity lingering_insanity(37)
0:56.479 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.0/100: 71% insanity lingering_insanity(37)
0:56.479 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 71.0/100: 71% insanity voidform, insanity_drain_stacks
0:57.741 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 67.7/100: 68% insanity voidform(2), insanity_drain_stacks(2)
0:58.992 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 63.9/100: 64% insanity voidform(3), insanity_drain_stacks(3)
1:00.222 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.9/100: 72% insanity raid_movement, voidform(4), insanity_drain_stacks(4)
1:01.437 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.4/100: 58% insanity voidform(5), insanity_drain_stacks(5)
1:02.652 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.0/100: 69% insanity voidform(7), insanity_drain_stacks(7)
1:03.839 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.7/100: 83% insanity voidform(8), insanity_drain_stacks(8)
1:06.167 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.2/100: 94% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10), mind_sear_on_hit_reset
1:07.320 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.5/100: 93% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11), mind_sear_on_hit_reset
1:08.469 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.4/100: 93% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12), mind_sear_on_hit_reset
1:10.085 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.5/100: 99% insanity twist_of_fate, voidform(14), insanity_drain_stacks(14), mind_sear_on_hit_reset
1:11.198 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.8/100: 87% insanity twist_of_fate, voidform(15), insanity_drain_stacks(15), mind_sear_on_hit_reset
1:15.579 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.4/100: 94% insanity twist_of_fate, voidform(20), insanity_drain_stacks(16)
1:16.641 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity raid_movement, twist_of_fate, voidform(21), insanity_drain_stacks(17)
1:17.694 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.2/100: 68% insanity twist_of_fate, voidform(22), insanity_drain_stacks(18)
1:18.739 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity twist_of_fate, voidform(23), insanity_drain_stacks(19)
1:19.774 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.0/100: 64% insanity twist_of_fate, voidform(24), insanity_drain_stacks(20)
1:21.082 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.1/100: 43% insanity raid_movement, voidform(25), insanity_drain_stacks(21)
1:22.099 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 27.1/100: 27% insanity raid_movement, voidform(26), insanity_drain_stacks(22)
1:23.108 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.4/100: 23% insanity raid_movement, voidform(27), insanity_drain_stacks(23)
1:24.108 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.4/100: 6% insanity voidform(28), insanity_drain_stacks(24)
1:25.106 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(28)
1:26.104 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(28)
1:27.100 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(28)
1:28.096 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity lingering_insanity(28)
1:29.093 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity lingering_insanity(28)
1:30.091 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.0/100: 40% insanity lingering_insanity(28)
1:31.597 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.0/100: 67% insanity lingering_insanity(28), mind_sear_on_hit_reset
1:32.594 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.0/100: 67% insanity raid_movement, lingering_insanity(28), mind_sear_on_hit_reset
1:33.590 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity lingering_insanity(28), mind_sear_on_hit_reset
1:33.590 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity voidform, insanity_drain_stacks, mind_sear_on_hit_reset
1:36.091 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.9/100: 69% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3), mind_sear_on_hit_reset
1:37.321 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.9/100: 81% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
1:39.258 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.7/100: 78% insanity twist_of_fate, voidform(6), insanity_drain_stacks(6), mind_sear_on_hit_reset
1:40.462 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.7/100: 80% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7), mind_sear_on_hit_reset
1:41.643 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.2/100: 81% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
1:44.157 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.1/100: 60% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
1:45.300 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.9/100: 60% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
1:46.439 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.7/100: 56% insanity twist_of_fate, voidform(13), insanity_drain_stacks(13)
1:47.569 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.4/100: 50% insanity twist_of_fate, voidform(14), insanity_drain_stacks(14)
1:48.678 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.8/100: 49% insanity raid_movement, twist_of_fate, voidform(16), insanity_drain_stacks(16)
1:49.775 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.1/100: 38% insanity voidform(17), insanity_drain_stacks(17)
1:51.091 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 15.1/100: 15% insanity raid_movement, voidform(18), insanity_drain_stacks(18)
1:52.168 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.7/100: 21% insanity raid_movement, voidform(19), insanity_drain_stacks(19)
1:53.234 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.8/100: 5% insanity raid_movement, voidform(20), insanity_drain_stacks(20)
1:54.292 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity lingering_insanity(21)
1:55.347 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(21)
1:56.403 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity lingering_insanity(21)
1:57.457 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(21)
1:58.510 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity lingering_insanity(21)
1:59.565 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 40.0/100: 40% insanity lingering_insanity(21)
2:00.622 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity lingering_insanity(21)
2:01.677 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity lingering_insanity(21)
2:02.733 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity lingering_insanity(21)
2:04.217 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.0/100: 94% insanity raid_movement, twist_of_fate, lingering_insanity(21), mind_sear_on_hit_reset
2:04.217 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.0/100: 94% insanity raid_movement, twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
2:05.479 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.7/100: 94% insanity twist_of_fate, voidform(2), insanity_drain_stacks(2), mind_sear_on_hit_reset
2:07.540 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.5/100: 99% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
2:08.761 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.5/100: 95% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5), mind_sear_on_hit_reset
2:10.623 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.6/100: 93% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7), mind_sear_on_hit_reset
2:11.815 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.8/100: 95% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8), mind_sear_on_hit_reset
2:12.988 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.8/100: 93% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
2:17.171 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.4/100: 97% insanity twist_of_fate, voidform(13), insanity_drain_stacks(9)
2:18.288 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.6/100: 90% insanity twist_of_fate, voidform(15), insanity_drain_stacks(11)
2:19.397 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.2/100: 86% insanity twist_of_fate, voidform(16), insanity_drain_stacks(12)
2:20.673 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 69.5/100: 69% insanity voidform(17), insanity_drain_stacks(13)
2:21.759 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 73.7/100: 74% insanity voidform(18), insanity_drain_stacks(14)
2:22.840 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 60.6/100: 61% insanity voidform(19), insanity_drain_stacks(15)
2:23.911 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 51.8/100: 52% insanity voidform(20), insanity_drain_stacks(16)
2:24.967 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.2/100: 50% insanity voidform(21), insanity_drain_stacks(17)
2:26.022 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 43.5/100: 44% insanity voidform(22), insanity_drain_stacks(18)
2:27.068 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 32.8/100: 33% insanity voidform(23), insanity_drain_stacks(19)
2:28.095 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 30.8/100: 31% insanity voidform(24), insanity_drain_stacks(20)
2:29.124 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 18.9/100: 19% insanity voidform(25), insanity_drain_stacks(21)
2:30.145 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.9/100: 8% insanity voidform(26), insanity_drain_stacks(22)
2:31.151 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.0/100: 8% insanity voidform(27), insanity_drain_stacks(23)
2:32.156 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(28)
2:36.172 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity raid_movement, twist_of_fate, lingering_insanity(28), mind_sear_on_hit_reset
2:36.172 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity raid_movement, twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
2:37.429 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.7/100: 66% insanity twist_of_fate, voidform(2), insanity_drain_stacks(2), mind_sear_on_hit_reset
2:39.325 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.4/100: 73% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
2:40.546 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5), mind_sear_on_hit_reset
2:41.760 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.8/100: 84% insanity twist_of_fate, voidform(6), insanity_drain_stacks(6), mind_sear_on_hit_reset
2:42.962 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.9/100: 78% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7)
2:44.145 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.5/100: 83% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8)
2:46.732 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.0/100: 61% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
2:47.875 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.9/100: 61% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
2:49.014 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.7/100: 57% insanity twist_of_fate, voidform(13), insanity_drain_stacks(13)
2:50.302 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 43.0/100: 43% insanity raid_movement, voidform(15), insanity_drain_stacks(15)
2:51.408 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.4/100: 45% insanity raid_movement, voidform(16), insanity_drain_stacks(16)
2:52.505 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.5/100: 30% insanity raid_movement, voidform(17), insanity_drain_stacks(17)
2:53.591 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 18.8/100: 19% insanity voidform(18), insanity_drain_stacks(18)
2:54.667 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.4/100: 20% insanity voidform(19), insanity_drain_stacks(19)
2:55.741 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 16.6/100: 17% insanity voidform(20), insanity_drain_stacks(20)
2:56.803 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 8.0/100: 8% insanity lingering_insanity(21)
2:57.859 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(21)
2:58.914 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(21)
2:59.970 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(21)
3:01.026 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(21)
3:02.081 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity lingering_insanity(21)
3:04.401 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity twist_of_fate, lingering_insanity(21), mind_sear_on_hit_reset
3:04.401 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
3:06.902 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.9/100: 91% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3), mind_sear_on_hit_reset
3:08.133 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity raid_movement, twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
3:09.351 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.1/100: 90% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5), mind_sear_on_hit_reset
3:10.568 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.1/100: 92% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7)
3:11.758 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8)
3:14.453 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.4/100: 77% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
3:15.600 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
3:19.802 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.5/100: 82% insanity voidform(16), insanity_drain_stacks(12)
3:19.802 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.5/100: 82% insanity berserking, voidform(16), insanity_drain_stacks(12)
3:20.755 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.8/100: 85% insanity berserking, raid_movement, voidform(17), insanity_drain_stacks(13)
3:21.701 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.3/100: 74% insanity berserking, raid_movement, voidform(18), insanity_drain_stacks(14)
3:22.638 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 62.8/100: 63% insanity berserking, raid_movement, voidform(19), insanity_drain_stacks(15)
3:23.571 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.6/100: 64% insanity berserking, voidform(20), insanity_drain_stacks(16)
3:24.495 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.1/100: 49% insanity berserking, raid_movement, voidform(21), insanity_drain_stacks(17)
3:25.412 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 35.9/100: 36% insanity berserking, voidform(22), insanity_drain_stacks(18)
3:26.321 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 36.6/100: 37% insanity berserking, voidform(22), insanity_drain_stacks(18)
3:27.233 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 24.5/100: 24% insanity berserking, voidform(23), insanity_drain_stacks(19)
3:28.135 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 12.3/100: 12% insanity berserking, voidform(24), insanity_drain_stacks(20)
3:29.025 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.4/100: 15% insanity berserking, voidform(25), insanity_drain_stacks(21)
3:29.923 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(26)
3:30.936 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(26)
3:35.164 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.0/100: 87% insanity twist_of_fate, lingering_insanity(26), mind_sear_on_hit_reset
3:35.164 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.0/100: 87% insanity twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
3:37.073 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.7/100: 98% insanity twist_of_fate, voidform(2), insanity_drain_stacks(2), mind_sear_on_hit_reset
3:38.323 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
3:39.546 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.6/100: 92% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5), mind_sear_on_hit_reset
3:41.020 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.1/100: 75% insanity raid_movement, twist_of_fate, voidform(6), insanity_drain_stacks(6), mind_sear_on_hit_reset
3:42.213 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.4/100: 68% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8), mind_sear_on_hit_reset
3:43.391 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.8/100: 70% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
3:44.562 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.8/100: 71% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10)
3:45.720 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.6/100: 59% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
3:46.862 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.2/100: 63% insanity voidform(12), insanity_drain_stacks(12)
3:49.346 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.8/100: 38% insanity voidform(15), insanity_drain_stacks(15)
3:50.452 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.2/100: 36% insanity raid_movement, voidform(16), insanity_drain_stacks(16)
3:51.546 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.2/100: 25% insanity raid_movement, voidform(17), insanity_drain_stacks(17)
3:52.632 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 9.5/100: 10% insanity raid_movement, voidform(18), insanity_drain_stacks(18)
3:53.709 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.1/100: 7% insanity voidform(19), insanity_drain_stacks(19)
3:54.780 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(19)
3:55.852 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(19)
3:56.924 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity raid_movement, lingering_insanity(19)
3:57.997 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 27.0/100: 27% insanity lingering_insanity(19)
3:59.069 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity lingering_insanity(19)
4:00.141 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.0/100: 39% insanity lingering_insanity(19)
4:01.804 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity lingering_insanity(19), mind_sear_on_hit_reset
4:02.876 shadow_word_pain Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity lingering_insanity(19), mind_sear_on_hit_reset
4:03.947 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity lingering_insanity(19), mind_sear_on_hit_reset
4:03.947 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity voidform, insanity_drain_stacks, mind_sear_on_hit_reset
4:05.209 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.7/100: 82% insanity voidform(2), insanity_drain_stacks(2)
4:07.201 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.5/100: 97% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
4:08.423 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.5/100: 93% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5), mind_sear_on_hit_reset
4:10.196 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.8/100: 95% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7), mind_sear_on_hit_reset
4:11.388 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.4/100: 96% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8), mind_sear_on_hit_reset
4:12.565 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.9/100: 93% insanity raid_movement, twist_of_fate, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
4:13.730 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10)
4:14.889 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.1/100: 77% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
4:16.029 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.9/100: 81% insanity twist_of_fate, voidform(13), insanity_drain_stacks(13)
4:20.295 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 93.1/100: 93% insanity raid_movement, twist_of_fate, voidform(17), insanity_drain_stacks(13)
4:21.381 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.5/100: 84% insanity raid_movement, twist_of_fate, voidform(18), insanity_drain_stacks(14)
4:22.458 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.2/100: 85% insanity raid_movement, twist_of_fate, voidform(19), insanity_drain_stacks(15)
4:23.525 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 71.4/100: 71% insanity raid_movement, twist_of_fate, voidform(20), insanity_drain_stacks(16)
4:24.581 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity twist_of_fate, voidform(21), insanity_drain_stacks(17)
4:25.635 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 68.1/100: 68% insanity twist_of_fate, voidform(22), insanity_drain_stacks(18)
4:26.679 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 53.5/100: 54% insanity twist_of_fate, voidform(23), insanity_drain_stacks(19)
4:27.710 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 58.6/100: 59% insanity twist_of_fate, voidform(24), insanity_drain_stacks(20)
4:28.732 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.8/100: 40% insanity raid_movement, twist_of_fate, voidform(25), insanity_drain_stacks(21)
4:29.744 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 31.8/100: 32% insanity twist_of_fate, voidform(26), insanity_drain_stacks(22)
4:30.750 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.0/100: 31% insanity twist_of_fate, voidform(27), insanity_drain_stacks(23)
4:31.755 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.0/100: 27% insanity twist_of_fate, voidform(28), insanity_drain_stacks(24)
4:32.745 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.2/100: 37% insanity twist_of_fate, voidform(29), insanity_drain_stacks(25)
4:33.729 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.2/100: 40% insanity twist_of_fate, voidform(30), insanity_drain_stacks(26)
4:35.659 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.5/100: 29% insanity twist_of_fate, voidform(32), insanity_drain_stacks(28), mind_sear_on_hit_reset
4:36.618 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.9/100: 23% insanity twist_of_fate, voidform(33), insanity_drain_stacks(29), mind_sear_on_hit_reset
4:37.577 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.1/100: 21% insanity twist_of_fate, voidform(34), insanity_drain_stacks(30), mind_sear_on_hit_reset
4:38.524 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.6/100: 29% insanity twist_of_fate, voidform(35), insanity_drain_stacks(31)
4:39.465 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.8/100: 26% insanity twist_of_fate, voidform(36), insanity_drain_stacks(32)
4:40.919 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity twist_of_fate, voidform(37), insanity_drain_stacks(33), mind_sear_on_hit_reset
4:41.843 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 13.5/100: 14% insanity twist_of_fate, voidform(38), insanity_drain_stacks(34), mind_sear_on_hit_reset
4:42.762 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.9/100: 9% insanity twist_of_fate, voidform(39), insanity_drain_stacks(35), mind_sear_on_hit_reset
4:43.680 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(40)
4:44.886 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity raid_movement, twist_of_fate, lingering_insanity(40)
4:45.799 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity twist_of_fate, lingering_insanity(40)
4:49.225 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.0/100: 33% insanity twist_of_fate, lingering_insanity(40)
4:50.139 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.0/100: 37% insanity raid_movement, twist_of_fate, lingering_insanity(40)
4:51.054 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.0/100: 40% insanity raid_movement, twist_of_fate, lingering_insanity(40)
4:51.967 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.0/100: 47% insanity raid_movement, twist_of_fate, lingering_insanity(40)
4:52.880 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.0/100: 50% insanity raid_movement, twist_of_fate, lingering_insanity(40)
4:53.792 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 53.0/100: 53% insanity twist_of_fate, lingering_insanity(40)
4:54.705 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 57.0/100: 57% insanity twist_of_fate, lingering_insanity(40)
4:55.617 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.0/100: 61% insanity twist_of_fate, lingering_insanity(40)
4:56.531 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity twist_of_fate, lingering_insanity(40)
4:56.531 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity twist_of_fate, voidform, insanity_drain_stacks
4:57.795 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 69.7/100: 70% insanity twist_of_fate, voidform(2), insanity_drain_stacks(2)
4:59.043 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 65.9/100: 66% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3)
5:00.273 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.9/100: 74% insanity raid_movement, twist_of_fate, voidform(4), insanity_drain_stacks(4)
5:01.490 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.5/100: 87% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5)
5:03.473 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.2/100: 98% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7), mind_sear_on_hit_reset
5:04.651 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.7/100: 88% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
5:05.817 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.3/100: 90% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10), mind_sear_on_hit_reset
5:06.976 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.9/100: 91% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
5:08.715 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.0/100: 97% insanity twist_of_fate, voidform(13), insanity_drain_stacks(13), mind_sear_on_hit_reset
5:09.841 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.7/100: 91% insanity twist_of_fate, voidform(14), insanity_drain_stacks(14), mind_sear_on_hit_reset
5:10.956 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.1/100: 87% insanity twist_of_fate, voidform(15), insanity_drain_stacks(15), mind_sear_on_hit_reset
5:12.066 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.5/100: 89% insanity twist_of_fate, voidform(16), insanity_drain_stacks(16)
5:13.161 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.8/100: 90% insanity twist_of_fate, voidform(17), insanity_drain_stacks(17)
5:14.253 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.1/100: 91% insanity twist_of_fate, voidform(18), insanity_drain_stacks(18)
5:15.334 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.5/100: 80% insanity twist_of_fate, voidform(19), insanity_drain_stacks(19)
5:16.398 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.6/100: 85% insanity raid_movement, twist_of_fate, voidform(20), insanity_drain_stacks(20)
5:17.452 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.7/100: 76% insanity twist_of_fate, voidform(21), insanity_drain_stacks(21)
5:21.669 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.9/100: 76% insanity twist_of_fate, voidform(26), insanity_drain_stacks(22)
5:22.680 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.8/100: 73% insanity twist_of_fate, voidform(27), insanity_drain_stacks(23)
5:23.686 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.8/100: 64% insanity twist_of_fate, voidform(28), insanity_drain_stacks(24)
5:24.680 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.6/100: 79% insanity twist_of_fate, voidform(29), insanity_drain_stacks(25)
5:25.668 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.6/100: 74% insanity twist_of_fate, voidform(30), insanity_drain_stacks(26)
5:27.815 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.2/100: 39% insanity twist_of_fate, voidform(32), insanity_drain_stacks(28)
5:28.780 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity twist_of_fate, voidform(33), insanity_drain_stacks(29)
5:29.739 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.0/100: 23% insanity twist_of_fate, voidform(34), insanity_drain_stacks(30)
5:30.693 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.0/100: 5% insanity twist_of_fate, voidform(35), insanity_drain_stacks(31)
5:31.637 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity twist_of_fate, lingering_insanity(36)
5:32.734 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity raid_movement, twist_of_fate, lingering_insanity(36)
5:33.672 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity twist_of_fate, lingering_insanity(36)
5:34.609 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.0/100: 46% insanity twist_of_fate, lingering_insanity(36)
5:38.109 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity twist_of_fate, lingering_insanity(36)
5:38.109 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity twist_of_fate, voidform, insanity_drain_stacks
5:40.786 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.4/100: 63% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3)
5:42.015 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.9/100: 67% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4)
5:43.241 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.8/100: 70% insanity twist_of_fate, voidform(6), insanity_drain_stacks(6)
5:44.442 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.3/100: 90% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7)
5:45.629 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.6/100: 86% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8)
5:48.147 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.5/100: 69% insanity raid_movement, twist_of_fate, voidform(11), insanity_drain_stacks(11)
5:49.293 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.4/100: 69% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
5:50.433 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.9/100: 65% insanity twist_of_fate, voidform(13), insanity_drain_stacks(13)
5:51.562 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.7/100: 56% insanity twist_of_fate, voidform(14), insanity_drain_stacks(14)
5:52.677 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.6/100: 59% insanity twist_of_fate, voidform(15), insanity_drain_stacks(15)
5:53.782 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity twist_of_fate, voidform(16), insanity_drain_stacks(16)
5:54.881 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.6/100: 61% insanity twist_of_fate, voidform(17), insanity_drain_stacks(17)
5:55.964 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.9/100: 58% insanity twist_of_fate, voidform(18), insanity_drain_stacks(18)
5:57.048 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.1/100: 55% insanity twist_of_fate, voidform(19), insanity_drain_stacks(19)
5:58.119 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.3/100: 43% insanity twist_of_fate, voidform(21), insanity_drain_stacks(21)
5:58.119 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.3/100: 43% insanity twist_of_fate, voidform(21), insanity_drain_stacks(21), potion_of_deadly_grace
5:59.171 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.3/100: 39% insanity twist_of_fate, voidform(22), insanity_drain_stacks(22), potion_of_deadly_grace
6:01.463 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.2/100: 2% insanity twist_of_fate, voidform(24), insanity_drain_stacks(24), potion_of_deadly_grace
6:02.490 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity twist_of_fate, lingering_insanity(25), potion_of_deadly_grace
6:03.511 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity twist_of_fate, lingering_insanity(25), potion_of_deadly_grace
6:04.529 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity raid_movement, twist_of_fate, lingering_insanity(25), potion_of_deadly_grace
6:05.547 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.0/100: 37% insanity twist_of_fate, lingering_insanity(25), potion_of_deadly_grace
6:06.568 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.0/100: 57% insanity twist_of_fate, lingering_insanity(25), potion_of_deadly_grace
6:09.385 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.0/100: 87% insanity twist_of_fate, lingering_insanity(25), potion_of_deadly_grace
6:09.385 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.0/100: 87% insanity twist_of_fate, voidform, insanity_drain_stacks, potion_of_deadly_grace
6:12.114 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.9/100: 78% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3), potion_of_deadly_grace
6:13.344 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.4/100: 89% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), potion_of_deadly_grace
6:14.610 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.7/100: 100% insanity twist_of_fate, voidform(6), insanity_drain_stacks(6), potion_of_deadly_grace
6:15.810 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.9/100: 87% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7), potion_of_deadly_grace
6:16.995 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.8/100: 90% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8), potion_of_deadly_grace
6:19.611 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.1/100: 76% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11), potion_of_deadly_grace
6:19.802 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.3/100: 73% insanity berserking, twist_of_fate, voidform(11), insanity_drain_stacks(11), potion_of_deadly_grace
6:20.797 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.3/100: 75% insanity berserking, raid_movement, twist_of_fate, voidform(12), insanity_drain_stacks(12), potion_of_deadly_grace
6:21.784 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.6/100: 65% insanity berserking, twist_of_fate, voidform(13), insanity_drain_stacks(13), potion_of_deadly_grace
6:26.027 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.8/100: 61% insanity berserking, twist_of_fate, voidform(17), insanity_drain_stacks(13)
6:26.970 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.6/100: 63% insanity berserking, twist_of_fate, voidform(18), insanity_drain_stacks(14)
6:27.911 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.8/100: 64% insanity berserking, twist_of_fate, voidform(19), insanity_drain_stacks(15)
6:28.840 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.6/100: 83% insanity berserking, twist_of_fate, voidform(20), insanity_drain_stacks(16)
6:29.763 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.8/100: 88% insanity berserking, twist_of_fate, voidform(21), insanity_drain_stacks(17)
6:31.859 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.6/100: 64% insanity twist_of_fate, voidform(23), insanity_drain_stacks(19)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6255 5930 0
Agility 7831 7506 0
Stamina 32771 32771 20493
Intellect 30857 29150 20439 (729)
Spirit 1 1 0
Health 1966260 1966260 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 30857 29150 0
Crit 32.68% 32.68% 9689
Haste 18.00% 16.84% 5474
Damage / Heal Versatility 2.76% 2.76% 1102
ManaReg per Second 8800 8800 0
Mastery 53.08% 53.08% 4632
Armor 1647 1647 1647
Run Speed 7 0 333

Gear

Source Slot Average Item Level: 858.00
Local Head Hood of Darkened Visions
ilevel: 860, stats: { 219 Armor, +2135 Sta, +1424 Int, +822 Crit, +532 Mastery }
Local Neck Blackened Portalstone Necklace
ilevel: 865, stats: { +1258 Sta, +1276 Crit, +665 Haste, +333 RunSpeed }
Local Shoulders Roggthread Mantle
ilevel: 845, stats: { 192 Armor, +929 Int, +1393 Sta, +666 Haste, +295 Vers }
Local Chest Maddening Robe of Secrets
ilevel: 850, stats: { 260 Armor, +1945 Sta, +1297 Int, +876 Mastery, +428 Crit }
Local Waist Bonespeaker Cinch
ilevel: 830, stats: { 136 Armor, +807 Int, +1211 Sta, +551 Crit, +356 Mastery }
Local Legs Legwraps of Rampant Turmoil
ilevel: 845, stats: { 224 Armor, +1238 Int, +1857 Sta, +777 Crit, +503 Haste }
Local Feet Norgannon's Foresight
ilevel: 895, stats: { 210 Armor, +2219 Sta, +1479 Int, +662 Haste, +496 Mastery }
Local Wrists Bracers of the High Priest
ilevel: 840, stats: { 110 Armor, +997 Sta, +665 Int, +475 Crit, +232 Haste }
Local Hands Handwraps of Delusional Power
ilevel: 855, stats: { 166 Armor, +1529 Sta, +1019 Int, +648 Haste, +349 Crit }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 850, stats: { +1094 Sta, +1258 Crit, +577 Haste }
Local Finger2 Cursed Warden's Keepsake
ilevel: 865, stats: { +1258 Sta, +1109 Crit, +832 Mastery }, enchant: { +150 Haste }
Local Trinket1 Unstable Horrorslime
ilevel: 860, stats: { +968 Crit }
Local Trinket2 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Back Gossamer-Spun Greatcloak
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +430 Mastery, +304 Crit }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 878, weapon: { 1480 - 2751, 1.8 }, stats: { +722 Int, +1082 Sta, +315 Crit, +303 Mastery, +9183 Int }, relics: { +45 ilevels, +43 ilevels, +40 ilevels }
Local Off Hand Secrets of the Void
ilevel: 878, stats: { +947 Int, +1421 Sta, +564 Haste, +250 Crit }

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Void Lord (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Shadow Crash (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Mind Spike (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Raji"
origin="https://us.api.battle.net/wow/character/thrall/Raji/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/153/136128921-avatar.jpg"
level=110
race=troll
role=spell
position=back
professions=tailoring=762/enchanting=715
talents=1212231
artifact=47:0:0:0:0:764:1:765:1:766:1:767:3:768:1:771:3:772:1:773:3:774:1:775:3:777:3:778:3:1347:1
spec=shadow

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
actions+=/variable,op=set,name=actors_fight_time_mod,value=0
actions+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions+=/variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions+=/variable,op=min,name=s2mcheck,value=180
actions+=/call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/call_action_list,name=vf,if=buff.voidform.up
actions+=/call_action_list,name=main

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
actions.main+=/shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
actions.main+=/shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
actions.main+=/mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_sear,if=active_enemies>=3,interrupt=1,chain=1
actions.main+=/mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
actions.main+=/mind_spike,if=talent.mind_spike.enabled
actions.main+=/shadow_word_pain

actions.s2m=shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
actions.s2m+=/power_infusion,if=buff.insanity_drain_stacks.stack>=85
actions.s2m+=/berserking,if=buff.voidform.stack>=90
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt
actions.s2m+=/void_torrent
actions.s2m+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.s2m+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.s2m+=/mind_blast
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.s2m+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
actions.s2m+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.s2m+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.s2m+=/mind_spike,if=talent.mind_spike.enabled

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
actions.vf+=/berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt
actions.vf+=/void_torrent,if=!talent.surrender_to_madness.enabled
actions.vf+=/void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
actions.vf+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
actions.vf+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.vf+=/mind_blast
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.vf+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.vf+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.vf+=/mind_spike,if=talent.mind_spike.enabled
actions.vf+=/shadow_word_pain

head=hood_of_darkened_visions,id=139189,bonus_id=1807/1808/1482/3336
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/42/1487/3337
shoulders=roggthread_mantle,id=134177,bonus_id=1727/1507/3336
back=gossamerspun_greatcloak,id=138221,bonus_id=1807/1472
chest=maddening_robe_of_secrets,id=139193,bonus_id=1807/1472
wrists=bracers_of_the_high_priest,id=139762,bonus_id=3386/3384
hands=handwraps_of_delusional_power,id=138212,bonus_id=1807/1808/1477/3336
waist=bonespeaker_cinch,id=134215,bonus_id=3397/1492/1675
legs=legwraps_of_rampant_turmoil,id=137453,bonus_id=1727/1497/3336
feet=norgannons_foresight,id=132455,bonus_id=1811
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1807/1472
finger2=cursed_wardens_keepsake,id=141546,bonus_id=1477/3336,enchant=150haste
trinket1=unstable_horrorslime,id=138224,bonus_id=1807/1808/1482/3336
trinket2=unstable_arcanocrystal,id=141482,bonus_id=1472
main_hand=xalatath_blade_of_the_black_empire,id=128827,bonus_id=740,gem_id=137347/139257/137377/0,relic_id=1727:1507:3337/1807:1472/1727:1492:1813/0
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=857.88
# gear_stamina=20493
# gear_intellect=20439
# gear_crit_rating=9689
# gear_haste_rating=5474
# gear_mastery_rating=4632
# gear_versatility_rating=1102
# gear_speed_rating=333
# gear_armor=1647

Vait

Vait : 386330 dps, 271078 dps to main target

  • Race: Undead
  • Class: Rogue
  • Spec: Outlaw
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
386330.4 386330.4 571.2 / 0.148% 112776.9 / 29.2% 13736.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
28.0 28.0 Energy 13.81% 63.2 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Vait/advanced
Talents
  • 15: Ghostly Strike (Outlaw Rogue)
  • 30: Grappling Hook (Outlaw Rogue)
  • 45: Deeper Stratagem
  • 60: Cheat Death
  • 75: Dirty Tricks (Outlaw Rogue)
  • 90: Alacrity
  • 100: Marked for Death
  • Talent Calculator
Artifact
Professions
  • herbalism: 114
  • skinning: 800
Scale Factors for Vait Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 13.72 9.20 7.67 7.59 5.03
Normalized 1.00 0.67 0.56 0.55 0.37
Scale Deltas 1138 1138 1138 1138 1138
Error 0.72 0.71 0.70 0.70 0.70
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit ~= Haste > Mastery
Pawn string ( Pawn: v1: "Vait": Agility=13.72, CritRating=7.67, HasteRating=7.59, MasteryRating=5.03, Versatility=9.20 )

Scale Factors for other metrics

Scale Factors for Vait Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 13.72 9.20 7.67 7.59 5.03
Normalized 1.00 0.67 0.56 0.55 0.37
Scale Deltas 1138 1138 1138 1138 1138
Error 0.72 0.71 0.70 0.70 0.70
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit ~= Haste > Mastery
Pawn string ( Pawn: v1: "Vait": Agility=13.72, CritRating=7.67, HasteRating=7.59, MasteryRating=5.03, Versatility=9.20 )
Scale Factors for Vait Priority Target Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 9.88 6.50 5.42 5.05 4.06
Normalized 1.00 0.66 0.55 0.51 0.41
Scale Deltas 1138 1138 1138 1138 1138
Error 0.39 0.38 0.38 0.38 0.38
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit ~= Haste > Mastery
Pawn string ( Pawn: v1: "Vait": Agility=9.88, CritRating=5.42, HasteRating=5.05, MasteryRating=4.06, Versatility=6.50 )
Scale Factors for Vait Damage Per Second (Effective)
Agi Vers Crit Haste Mastery
Scale Factors 13.72 9.20 7.67 7.59 5.03
Normalized 1.00 0.67 0.56 0.55 0.37
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Vait": Agility=13.72, CritRating=7.67, HasteRating=7.59, MasteryRating=5.03, Versatility=9.20 )
Scale Factors for Vait Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for VaitTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Vait 386330
Ambush 2640 0.7% 7.0 64.88sec 150381 149711 Direct 7.0 111693 224023 150386 34.4% 0.0%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.02 7.02 0.00 0.00 1.0045 0.0000 1055009.93 1550964.54 31.98 149710.51 149710.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.60 65.56% 111693.34 103906 114297 111378.94 0 114297 513719 755216 31.92
crit 2.42 34.44% 224023.10 207812 228593 210012.08 0 228593 541291 795748 29.99
 
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=2} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.50
 
auto_attack_mh 20238 5.3% 256.0 1.57sec 31670 24826 Direct 256.0 27023 54051 31670 36.2% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 256.00 256.00 0.00 0.00 1.2757 0.0000 8107485.23 11918771.25 31.98 24825.87 24825.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 114.63 44.78% 27023.19 24648 27113 27022.09 26667 27113 3097549 4553691 31.98
crit 92.69 36.21% 54050.90 49296 54225 54050.72 53207 54225 5009936 7365080 31.98
miss 48.68 19.02% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 9386 2.4% 237.4 1.69sec 15841 11441 Direct 237.4 13515 27030 15841 36.2% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 237.44 237.44 0.00 0.00 1.3845 0.0000 3761224.89 5529356.87 31.98 11441.16 11441.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.31 44.78% 13515.39 12324 13556 13514.94 13363 13556 1436873 2112339 31.98
crit 85.99 36.22% 27029.90 24648 27113 27030.13 26615 27113 2324352 3417018 31.98
miss 45.13 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blade Flurry (_attack) 81107 20.8% 416.8 0.98sec 76817 0 Direct 2084.2 15363 0 15363 0.0% 0.0%  

Stats details: blade_flurry_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 416.83 2084.15 0.00 0.00 0.0000 0.0000 32019513.24 47071717.44 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2084.15 100.00% 15363.49 4313 80008 15372.42 13032 18097 32019513 47071717 31.98
 
 

Action details: blade_flurry_attack

Static Values
  • id:22482
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:22482
  • name:Blade Flurry
  • school:physical
  • tooltip:
  • description:{$@spelldesc13877=While active, your melee attacks also strike all nearby enemies for {$s3=35}% of normal damage$?s56818[ and the application chance of Non-Lethal poisons is increased by {$s2=0}%][], but your Energy regeneration is reduced by {$s1=20}%. Lasts until cancelled.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19929.14
  • base_dd_max:19929.14
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Ghostly Strike 4023 1.0% 27.0 15.06sec 59760 62300 Direct 27.0 43851 87770 59760 36.2% 0.0%  

Stats details: ghostly_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.97 26.97 128.92 0.00 0.9593 2.9877 1611563.84 2369151.49 31.98 3920.64 62299.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.20 63.78% 43851.13 40640 44704 43840.38 42092 44704 754197 1108741 31.98
crit 9.77 36.22% 87770.26 81280 89408 87754.51 81280 89408 857367 1260411 31.98
 
 

Action details: ghostly_strike

Static Values
  • id:196937
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
Spelldata
  • id:196937
  • name:Ghostly Strike
  • school:physical
  • tooltip:Taking {$s5=10}% increased damage from the Rogue's abilities.
  • description:Strikes an enemy with your cursed weapon, dealing $sw2 Physical damage and causing the target to take {$s5=10}% increased damage from your abilities for {$d=15 seconds}. |cFFFFFFFFAwards {$s1=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.76
 
Greed 33262 (49886) 8.6% (12.8%) 34.8 11.32sec 568230 0 Direct 116.2 83168 166362 113438 36.4% 0.0%  

Stats details: greed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.78 116.17 0.00 0.00 0.0000 0.0000 13178387.84 19373478.42 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.91 63.62% 83167.94 80816 88897 83200.75 81810 85605 6146561 9036027 31.98
crit 42.27 36.38% 166362.07 161632 177795 166442.31 162209 172652 7031827 10337452 31.98
 
 

Action details: greed

Static Values
  • id:202822
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202822
  • name:Greed
  • school:physical
  • tooltip:
  • description:{$@spelldesc202820=Run Through occasionally awakens |cFFFFCC99The Dreadblades|r, unleashing a sweeping attack against all nearby enemies for ${$202822sw2 + $202823sw2} Physical damage, and healing you for ${$MHP*.05} per target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
    Greed (_oh) 16624 4.3% 34.8 11.32sec 189371 0 Direct 116.2 41584 83181 56696 36.3% 0.0%  

Stats details: greed_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.78 116.17 0.00 0.00 0.0000 0.0000 6586339.22 9682542.53 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.97 63.67% 41583.79 40408 44449 41600.28 40932 42743 3075877 4521831 31.98
crit 42.20 36.33% 83181.30 80816 88897 83221.59 81139 86204 3510462 5160712 31.98
 
 

Action details: greed_oh

Static Values
  • id:202823
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202823
  • name:Greed
  • school:physical
  • tooltip:
  • description:{$@spelldesc202820=Run Through occasionally awakens |cFFFFCC99The Dreadblades|r, unleashing a sweeping attack against all nearby enemies for ${$202822sw2 + $202823sw2} Physical damage, and healing you for ${$MHP*.05} per target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
Main Gauche 23912 6.2% 240.6 1.69sec 39825 0 Direct 240.6 29247 58497 39826 36.2% 0.0%  

Stats details: main_gauche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 240.61 240.61 0.00 0.00 0.0000 0.0000 9582287.05 14086869.63 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 153.59 63.84% 29247.07 26671 29338 29246.00 28880 29338 4492166 6603910 31.98
crit 87.01 36.16% 58497.31 53342 58676 58497.21 57058 58676 5090121 7482959 31.98
 
 

Action details: main_gauche

Static Values
  • id:86392
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:
  • description:A vicious attack that deals $86392sw2 Physical damage with your off-hand.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.10
 
Pistol Shot 7524 2.0% 43.7 8.62sec 69210 71326 Direct 43.7 44890 89775 69210 54.2% 0.0%  

Stats details: pistol_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.65 43.65 0.00 0.00 0.9703 0.0000 3021152.62 4441380.53 31.98 71325.93 71325.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.00 45.82% 44890.02 40890 44979 44888.26 43810 44979 897815 1319872 31.98
crit 23.65 54.18% 89775.04 81779 89957 89772.40 87621 89957 2123338 3121508 31.98
 
 

Action details: pistol_shot

Static Values
  • id:185763
  • school:physical
  • resource:energy
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&energy.time_to_max>2-talent.quick_draw.enabled
Spelldata
  • id:185763
  • name:Pistol Shot
  • school:physical
  • tooltip:Movement speed reduced by {$s3=50}%.
  • description:Draw a concealed pistol and fire a quick shot at an enemy, dealing {$s1=0} Physical damage and reducing movement speed by {$s3=50}% for {$d=6 seconds}. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
 
Potion of the Old War 11982 3.1% 26.3 5.48sec 179671 0 Direct 26.3 131881 264243 179676 36.1% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.33 26.33 0.00 0.00 0.0000 0.0000 4730447.09 6954205.30 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.82 63.89% 131880.87 121121 133233 131867.67 126076 133233 2218549 3261478 31.98
crit 9.51 36.11% 264242.67 242242 266466 264170.96 0 266466 2511898 3692727 31.97
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Run Through 113953 29.6% 99.3 4.00sec 458842 486123 Direct 99.3 336467 672485 458848 36.4% 0.0%  

Stats details: run_through

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.32 99.32 0.00 0.00 0.9439 0.0000 45570581.75 66993071.73 31.98 486122.50 486122.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.15 63.58% 336467.07 258656 387984 336793.06 312185 363351 21247081 31235222 31.98
crit 36.17 36.42% 672485.01 517514 775969 673446.15 608405 732638 24323500 35757850 31.98
 
 

Action details: run_through

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Run Through
  • school:physical
  • tooltip:Rooted.
  • description:Lunging finishing move that causes damage per combo point and has increased range: 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
 
Saber Slash 59044 15.4% 216.9 1.84sec 109137 168449 Direct 216.9 80091 160195 109139 36.3% 0.0%  

Stats details: saber_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 216.89 216.89 0.00 0.00 0.6479 0.0000 23670777.21 34798284.65 31.98 168448.91 168448.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 138.24 63.74% 80091.13 73023 80325 80087.34 79172 80325 11072114 16277057 31.98
crit 78.65 36.26% 160195.34 146046 160650 160194.59 157649 160650 12598663 18521228 31.98
 
 

Action details: saber_slash

Static Values
  • id:193315
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.ss_useable
Spelldata
  • id:193315
  • name:Saber Slash
  • school:physical
  • tooltip:
  • description:Viciously slash an enemy, causing ${$sw1*$<mult>} Physical damage. Saber Slash has a {$s5=35}% chance to strike an additional time, making your next Pistol Shot free. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points; each time it strikes.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.75
 
Touch of the Grave 2635 0.7% 24.1 16.89sec 43757 0 Direct 24.1 43757 0 43757 0.0% 0.0%  

Stats details: touch_of_the_grave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.12 24.12 0.00 0.00 0.0000 0.0000 1055528.47 1055528.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.12 100.00% 43756.98 40074 44082 43753.85 42605 44082 1055528 1055528 0.00
 
 

Action details: touch_of_the_grave

Static Values
  • id:127802
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:127802
  • name:Touch of the Grave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc5227=Your attacks and damaging spells have a chance to drain the target, dealing ${$max($AP,$SPH)*$pctD*(1+$@versadmg)} Shadow damage and healing you for the same amount. Additionally, you can breathe underwater indefinitely.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Vait
Adrenaline Rush 5.9 70.90sec

Stats details: adrenaline_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.90 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: adrenaline_rush

Static Values
  • id:13750
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.adrenaline_rush.up&energy.deficit>0
Spelldata
  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vait
  • harmful:false
  • if_expr:
 
Blade Flurry 10.0 29.99sec

Stats details: blade_flurry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blade_flurry

Static Values
  • id:13877
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:spell_targets.blade_flurry>=2&!buff.blade_flurry.up
Spelldata
  • id:13877
  • name:Blade Flurry
  • school:physical
  • tooltip:Attacking additional enemies. Energy regeneration reduced by $w1%.$?$w2!=0[ Non-Lethal poison application chance increased by $w2%.][]
  • description:While active, your melee attacks also strike all nearby enemies for {$s3=35}% of normal damage$?s56818[ and the application chance of Non-Lethal poisons is increased by {$s2=0}%][], but your Energy regeneration is reduced by {$s1=20}%. Lasts until cancelled.
 
Curse of the Dreadblades 4.8 91.86sec

Stats details: curse_of_the_dreadblades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: curse_of_the_dreadblades

Static Values
  • id:202665
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)
Spelldata
  • id:202665
  • name:Curse of the Dreadblades
  • school:shadow
  • tooltip:Saber Slash and Pistol Shot will refill all of your combo points when used.
  • description:Invoke the Curse of the Dreadblades, causing each Saber Slash or Pistol Shot to fill your combo points. However, |cFFFFCC99The Dreadblades|r will consume {$202669s1=5}% of your current health when you use a finishing move for the next {$d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vait
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vait
  • harmful:false
  • if_expr:
 
Gouge 19.9 18.27sec

Stats details: gouge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.94 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: gouge

Static Values
  • id:1776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dirty_tricks.enabled&combo_points.deficit>=1
Spelldata
  • id:1776
  • name:Gouge
  • school:physical
  • tooltip:Incapacitated.$?$w2!=0[ Damage taken increased by $w2%.][]
  • description:Gouges the eyes of an enemy target, incapacitating for {$d=4 seconds}. Damage will interrupt the effect. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
 
Marked for Death 12.8 24.03sec

Stats details: marked_for_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: marked_for_death

Static Values
  • id:137619
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:raid_event.adds.in>40
Spelldata
  • id:137619
  • name:Marked for Death
  • school:physical
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating {$s1=0} combo points. Cooldown reset if the target dies within {$d=60 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Roll the Bones 16.3 24.49sec

Stats details: roll_the_bones

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.31 0.00 0.00 0.00 0.9519 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: roll_the_bones

Static Values
  • id:193316
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.slice_and_dice.enabled
Spelldata
  • id:193316
  • name:Roll the Bones
  • school:physical
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
 
Sprint 8.3 49.10sec

Stats details: sprint

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.32 0.00 264.41 0.00 0.0000 0.2500 0.00 0.00 0.00 0.00 0.00
 
 

Action details: sprint

Static Values
  • id:2983
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.thraxis_tricksy_treads&!variable.ss_useable
Spelldata
  • id:2983
  • name:Sprint
  • school:physical
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vanish 6.0 64.71sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.03 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:variable.stealth_condition
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Adrenaline Rush 5.9 0.0 70.9sec 70.9sec 21.86% 21.92% 0.0(0.0) 5.7

Buff details

  • buff initial source:Vait
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • adrenaline_rush_1:21.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Alacrity 1.0 114.6 0.0sec 3.5sec 99.34% 100.00% 98.3(111.9) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_alacrity
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01

Stack Uptimes

  • alacrity_1:0.35%
  • alacrity_2:0.31%
  • alacrity_3:0.34%
  • alacrity_4:0.33%
  • alacrity_5:0.34%
  • alacrity_6:0.36%
  • alacrity_7:0.38%
  • alacrity_8:0.43%
  • alacrity_9:0.55%
  • alacrity_10:0.75%
  • alacrity_11:0.91%
  • alacrity_12:0.92%
  • alacrity_13:0.86%
  • alacrity_14:0.79%
  • alacrity_15:0.79%
  • alacrity_16:0.81%
  • alacrity_17:0.86%
  • alacrity_18:0.89%
  • alacrity_19:0.90%
  • alacrity_20:87.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=1}% for {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blade Flurry 10.0 0.0 30.0sec 30.0sec 50.61% 50.61% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_blade_flurry
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blade_flurry_1:50.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13877
  • name:Blade Flurry
  • tooltip:Attacking additional enemies. Energy regeneration reduced by $w1%.$?$w2!=0[ Non-Lethal poison application chance increased by $w2%.][]
  • description:While active, your melee attacks also strike all nearby enemies for {$s3=35}% of normal damage$?s56818[ and the application chance of Non-Lethal poisons is increased by {$s2=0}%][], but your Energy regeneration is reduced by {$s1=20}%. Lasts until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Blood Frenzy 14.2 8.8 28.4sec 17.2sec 45.24% 45.24% 8.8(8.8) 13.7

Buff details

  • buff initial source:Vait
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2957.63

Stack Uptimes

  • blood_frenzy_1:45.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 18.20% 0.0(0.0) 1.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Broadsides 4.1 0.0 74.6sec 74.6sec 27.60% 24.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_broadsides
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • broadsides_1:27.60%

Trigger Attempt Success

  • trigger_pct:98.68%

Spelldata details

  • id:193356
  • name:Broadsides
  • tooltip:Your attacks generate {$s1=1} additional combo point.
  • description:Your combo-generating abilities generate {$s1=1} additional combo point for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Buried Treasure 4.1 0.0 74.5sec 74.5sec 28.54% 27.50% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_buried_treasure
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • buried_treasure_1:28.54%

Trigger Attempt Success

  • trigger_pct:98.82%

Spelldata details

  • id:199600
  • name:Buried Treasure
  • tooltip:Increases Energy regeneration by {$s1=25}%.
  • description:Your base Energy regeneration is increased by {$s1=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Curse of the Dreadblades 4.8 0.0 91.9sec 91.9sec 14.20% 14.52% 0.0(0.0) 4.7

Buff details

  • buff initial source:Vait
  • cooldown name:buff_curse_of_the_dreadblades
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • curse_of_the_dreadblades_1:14.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202665
  • name:Curse of the Dreadblades
  • tooltip:Saber Slash and Pistol Shot will refill all of your combo points when used.
  • description:Invoke the Curse of the Dreadblades, causing each Saber Slash or Pistol Shot to fill your combo points. However, |cFFFFCC99The Dreadblades|r will consume {$202669s1=5}% of your current health when you use a finishing move for the next {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:90.00
  • default_chance:101.00%
Grand Melee 4.1 0.0 74.6sec 74.6sec 28.49% 27.44% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_grand_melee
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.67

Stack Uptimes

  • grand_melee_1:28.49%

Trigger Attempt Success

  • trigger_pct:98.71%

Spelldata details

  • id:193358
  • name:Grand Melee
  • tooltip:Attack speed increased by {$s1=50}%. Leech increased by {$s2=25}%.
  • description:Increases your attack speed by {$s1=50}% and your Leech by {$s2=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hidden Blade 7.0 0.0 58.5sec 64.8sec 4.25% 5.25% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_hidden_blade
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hidden_blade_1:4.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202754
  • name:Hidden Blade
  • tooltip:Your next Saber Slash has 100% chance to strike a second time.
  • description:{$@spelldesc202753=Successfully using Ambush guarantees your next Saber Slash will strike an additional time.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Jolly Roger 4.1 0.0 74.3sec 74.3sec 28.35% 28.17% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_jolly_roger
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • jolly_roger_1:28.35%

Trigger Attempt Success

  • trigger_pct:98.91%

Spelldata details

  • id:199603
  • name:Jolly Roger
  • tooltip:Saber Slash has an additional {$s1=25}% chance of striking an additional time.
  • description:Causes Saber Slash to have an additional {$s1=25}% chance of striking an additional time for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Opportunity 44.6 18.2 8.9sec 6.3sec 37.31% 37.31% 18.2(18.2) 0.7

Buff details

  • buff initial source:Vait
  • cooldown name:buff_opportunity
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • opportunity_1:37.31%

Trigger Attempt Success

  • trigger_pct:42.03%

Spelldata details

  • id:195627
  • name:Opportunity
  • tooltip:Your next Pistol Shot is free.
  • description:{$@spelldesc193315=Viciously slash an enemy, causing ${$sw1*$<mult>} Physical damage. Saber Slash has a {$s5=35}% chance to strike an additional time, making your next Pistol Shot free. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points; each time it strikes.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of the Old War 2.0 0.0 110.6sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.9 1.9 11.9sec 11.3sec 11.96% 11.96% 1.9(1.9) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:11.96%

Trigger Attempt Success

  • trigger_pct:100.00%
Roll the Bones 2.9 13.4 129.5sec 24.4sec 98.82% 98.82% 13.4(13.4) 1.9

Buff details

  • buff initial source:Vait
  • cooldown name:buff_roll_the_bones
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roll_the_bones_1:98.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193316
  • name:Roll the Bones
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Shark Infested Waters 4.1 0.0 75.4sec 75.4sec 30.03% 48.66% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_shark_infested_waters
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • shark_infested_waters_1:30.03%

Trigger Attempt Success

  • trigger_pct:98.98%

Spelldata details

  • id:193357
  • name:Shark Infested Waters
  • tooltip:Critical Strike chance increased by {$s1=25}%.
  • description:Increases Critical Strike chance by {$s1=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Sprint 8.3 0.0 49.0sec 49.0sec 16.53% 12.42% 264.4(264.4) 8.2

Buff details

  • buff initial source:Vait
  • cooldown name:buff_sprint
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sprint_1:16.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2983
  • name:Sprint
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Stealth 1.0 0.0 167.2sec 90.1sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:200.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
True Bearing 4.1 0.0 81.5sec 81.5sec 43.94% 44.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_true_bearing
  • max_stacks:1
  • duration:0.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:2.00

Stack Uptimes

  • true_bearing_1:43.94%

Trigger Attempt Success

  • trigger_pct:99.38%

Spelldata details

  • id:193359
  • name:True Bearing
  • tooltip:Finishers reduce the remaining cooldown on many of your abilities by {$s1=2} sec per combo point.
  • description:For the duration of Roll the Bones, each time you use a finishing move, you reduce the remaining cooldown on Adrenaline Rush, Sprint, Between the Eyes, Vanish, Blind, Cloak of Shadows, Riposte, Grappling Hook, Cannonball Barrage, Killing Spree, Marked for Death, and Death from Above by {$s1=2} sec per combo point spent.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Vanish 6.0 0.0 64.6sec 64.6sec 0.21% 0.21% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:0.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Vait
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Vait
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Vait
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Vait
ambush Energy 7.0 420.9 60.0 60.0 2506.4
ghostly_strike Energy 27.0 809.0 30.0 30.0 1992.0
roll_the_bones Energy 16.3 212.1 13.0 13.0 0.0
roll_the_bones Combo Points 16.3 89.7 5.5 5.5 0.0
run_through Energy 99.3 2284.3 23.0 23.0 19949.3
run_through Combo Points 99.3 569.9 5.7 5.7 79957.5
saber_slash Energy 216.9 7481.2 34.5 34.5 3164.0
Resource Gains Type Count Total Average Overflow
marked_for_death Combo Points 12.75 61.49 (9.28%) 4.82 2.26 3.55%
gouge Combo Points 19.94 19.94 (3.01%) 1.00 0.00 0.00%
ghostly_strike Combo Points 26.97 26.97 (4.07%) 1.00 0.00 0.00%
pistol_shot Combo Points 43.65 43.65 (6.59%) 1.00 0.00 0.00%
saber_slash Combo Points 216.89 201.35 (30.38%) 0.93 15.54 7.16%
adrenaline_rush Energy 311.33 1383.22 (12.41%) 4.44 198.56 12.55%
ambush Combo Points 7.02 14.03 (2.12%) 2.00 0.00 0.03%
energy_regen Energy 1426.51 6932.04 (62.20%) 4.86 237.25 3.31%
combat_potency Energy 179.19 2830.25 (25.39%) 15.79 36.82 1.28%
Broadsides Combo Points 75.35 67.45 (10.18%) 0.90 7.90 10.48%
Ruthlessness Combo Points 115.63 131.90 (19.90%) 1.14 0.00 0.00%
Curse of the Dreadblades Combo Points 27.88 96.06 (14.49%) 3.45 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 27.82 27.98
Combo Points 1.65 1.65
Combat End Resource Mean Min Max
Energy 38.58 0.02 100.00
Combo Points 3.16 1.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 2.5%

Procs

Count Interval
Roll the Bones: 1 buff 9.7 37.0sec
Roll the Bones: 2 buffs 5.8 64.7sec
Roll the Bones: 3 buffs 0.6 133.4sec
Roll the Bones: 6 buffs 0.3 138.9sec

Statistics & Data Analysis

Fight Length
Sample Data Vait Fight Length
Count 9999
Mean 400.62
Minimum 307.54
Maximum 499.01
Spread ( max - min ) 191.47
Range [ ( max - min ) / 2 * 100% ] 23.90%
DPS
Sample Data Vait Damage Per Second
Count 9999
Mean 386330.40
Minimum 305257.77
Maximum 556150.00
Spread ( max - min ) 250892.23
Range [ ( max - min ) / 2 * 100% ] 32.47%
Standard Deviation 29141.3441
5th Percentile 343682.24
95th Percentile 437724.08
( 95th Percentile - 5th Percentile ) 94041.85
Mean Distribution
Standard Deviation 291.4280
95.00% Confidence Intervall ( 385759.21 - 386901.59 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 218
0.1% Error 21857
0.1 Scale Factor Error with Delta=300 7249412
0.05 Scale Factor Error with Delta=300 28997650
0.01 Scale Factor Error with Delta=300 724941273
Priority Target DPS
Sample Data Vait Priority Target Damage Per Second
Count 9999
Mean 271077.72
Minimum 212790.58
Maximum 362085.12
Spread ( max - min ) 149294.55
Range [ ( max - min ) / 2 * 100% ] 27.54%
Standard Deviation 15692.7728
5th Percentile 247972.83
95th Percentile 299535.61
( 95th Percentile - 5th Percentile ) 51562.78
Mean Distribution
Standard Deviation 156.9356
95.00% Confidence Intervall ( 270770.13 - 271385.31 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 128
0.1% Error 12873
0.1 Scale Factor Error with Delta=300 2102243
0.05 Scale Factor Error with Delta=300 8408974
0.01 Scale Factor Error with Delta=300 210224361
DPS(e)
Sample Data Vait Damage Per Second (Effective)
Count 9999
Mean 386330.40
Minimum 305257.77
Maximum 556150.00
Spread ( max - min ) 250892.23
Range [ ( max - min ) / 2 * 100% ] 32.47%
Damage
Sample Data Vait Damage
Count 9999
Mean 153950298.39
Minimum 109962981.96
Maximum 213250785.63
Spread ( max - min ) 103287803.67
Range [ ( max - min ) / 2 * 100% ] 33.55%
DTPS
Sample Data Vait Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Vait Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Vait Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Vait Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Vait Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Vait Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data VaitTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Vait Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 roll_the_bones,if=!talent.slice_and_dice.enabled
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=rtb_reroll,value=!talent.slice_and_dice.enabled&(rtb_buffs<=1&!rtb_list.any.6&((!buff.curse_of_the_dreadblades.up&!buff.adrenaline_rush.up)|!rtb_list.any.5))
Condition to continue rerolling RtB (2- or not TB alone or not SIW alone during CDs); If SnD: consider that you never have to reroll.
0.00 variable,name=ss_useable_noreroll,value=(combo_points<5+talent.deeper_stratagem.enabled-(buff.broadsides.up|buff.jolly_roger.up)-(talent.alacrity.enabled&buff.alacrity.stack<=4))
Condition to use Saber Slash when not rerolling RtB or when using SnD
0.00 variable,name=ss_useable,value=(talent.anticipation.enabled&combo_points<4)|(!talent.anticipation.enabled&((variable.rtb_reroll&combo_points<4+talent.deeper_stratagem.enabled)|(!variable.rtb_reroll&variable.ss_useable_noreroll)))
Condition to use Saber Slash, when you have RtB or not
8 0.00 call_action_list,name=bf
Normal rotation
9 0.00 call_action_list,name=cds
A 0.00 call_action_list,name=stealth,if=stealthed|cooldown.vanish.up|cooldown.shadowmeld.up
Conditions are here to avoid worthless check if nothing is available
0.00 death_from_above,if=energy.time_to_max>2&!variable.ss_useable_noreroll
0.00 slice_and_dice,if=!variable.ss_useable&buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
B 16.31 roll_the_bones,if=!variable.ss_useable&buff.roll_the_bones.remains<target.time_to_die&(buff.roll_the_bones.remains<=3|variable.rtb_reroll)
0.00 killing_spree,if=energy.time_to_max>5|energy<15
C 0.00 call_action_list,name=build
D 0.00 call_action_list,name=finish,if=!variable.ss_useable
E 20.03 gouge,if=talent.dirty_tricks.enabled&combo_points.deficit>=1
Gouge is used as a CP Generator while nothing else is available and you have Dirty Tricks talent. It's unlikely that you'll be able to do this optimally in-game since it requires to move in front of the target, but it's here so you can quantifiy its value.
actions.bf Blade Flurry
# count action,conditions
F 10.00 cancel_buff,name=blade_flurry,if=equipped.shivarran_symmetry&cooldown.blade_flurry.up&buff.blade_flurry.up&spell_targets.blade_flurry>=2|spell_targets.blade_flurry<2&buff.blade_flurry.up
G 10.00 blade_flurry,if=spell_targets.blade_flurry>=2&!buff.blade_flurry.up
actions.build Builders
# count action,conditions
H 26.97 ghostly_strike,if=combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
I 43.65 pistol_shot,if=combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&energy.time_to_max>2-talent.quick_draw.enabled
J 149.62 saber_slash,if=variable.ss_useable
actions.cds Cooldowns
# count action,conditions
K 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.adrenaline_rush.up
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent,if=energy.deficit>40
0.00 cannonball_barrage,if=spell_targets.cannonball_barrage>=1
L 5.91 adrenaline_rush,if=!buff.adrenaline_rush.up&energy.deficit>0
M 12.75 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15)&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
N 8.33 sprint,if=equipped.thraxis_tricksy_treads&!variable.ss_useable
O 4.82 curse_of_the_dreadblades,if=combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)
actions.finish Finishers
# count action,conditions
0.00 between_the_eyes,if=equipped.greenskins_waterlogged_wristcuffs&buff.shark_infested_waters.up
P 99.32 run_through,if=!talent.death_from_above.enabled|energy.time_to_max<cooldown.death_from_above.remains+3.5
actions.stealth Stealth
# count action,conditions
0.00 variable,name=stealth_condition,value=(combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&!debuff.ghostly_strike.up)+buff.broadsides.up&energy>60&!buff.jolly_roger.up&!buff.hidden_blade.up&!buff.curse_of_the_dreadblades.up)
Condition to use stealth abilities
Q 7.02 ambush
R 6.03 vanish,if=variable.stealth_condition
0.00 shadowmeld,if=variable.stealth_condition

Sample Sequence

01245QLJHNBMPOJPJPJPJPMPJPJPJPRQHIGJNPJJIJPIJHJJBMBJJLBFJIBJJHJBJJJIGPJJIJPJEHJJPMPIJIJFPEJIHPJJGJJPIJJHPIJJBMBOJBJFBEJBJPIPJGHPRQJPJJNPEJPMPJPIHFPJEPJJPIJPGJPIHPEJPJPJPIJBMPJIFHJJPEJJJGPMPJLKRQHIPJJJJNPIJHJPMPOIPJFPJPJPIPJBJGBRQHENBJPJJPMPEHPFJPIJPJIPJGPJPJPJHPJPJJPMPLIJPFJHBJBIJIBJBJGJPJPIHPJEPJHPMPOJPFEJPIPJPGIHPJJPEJPIJBMPJNEPFIHPJJPIJPIEPJPIHPJLJPIRQPJNPJPJHBJJJPJJJIJPJIJPJEHJJPIJJEPJHIJPOIPJBJPIPJPJPJHIEPJJJ

Sample Sequence Table

time name target resources buffs
Pre flask Vait 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Vait 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre food Vait 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:00.000 ambush Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:01.005 adrenaline_rush Fluffy_Pillow 73.9/100: 74% energy | 2.0/6: 33% combo_points bloodlust, hidden_blade, potion_of_the_old_war
0:01.005 saber_slash Fluffy_Pillow 73.9/100: 74% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, hidden_blade, potion_of_the_old_war
0:01.809 ghostly_strike Fluffy_Pillow 52.4/100: 52% energy | 4.0/6: 67% combo_points bloodlust, adrenaline_rush, potion_of_the_old_war
0:02.613 sprint Fluffy_Pillow 67.0/100: 67% energy | 5.0/6: 83% combo_points bloodlust, adrenaline_rush, potion_of_the_old_war
0:02.613 roll_the_bones Fluffy_Pillow 67.0/100: 67% energy | 5.0/6: 83% combo_points bloodlust, adrenaline_rush, sprint, potion_of_the_old_war
0:03.418 marked_for_death Fluffy_Pillow 82.9/100: 83% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, sprint, alacrity, true_bearing, roll_the_bones, potion_of_the_old_war
0:03.418 run_through Fluffy_Pillow 82.9/100: 83% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, sprint, alacrity, true_bearing, roll_the_bones, potion_of_the_old_war
0:04.221 curse_of_the_dreadblades Fluffy_Pillow 89.0/100: 89% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, sprint, alacrity(2), true_bearing, roll_the_bones, potion_of_the_old_war
0:04.221 saber_slash Fluffy_Pillow 89.0/100: 89% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, sprint, alacrity(2), true_bearing, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:05.025 run_through Fluffy_Pillow 84.2/100: 84% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(2), true_bearing, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:05.829 saber_slash Fluffy_Pillow 90.6/100: 91% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(3), true_bearing, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:06.634 run_through Fluffy_Pillow 70.1/100: 70% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(3), true_bearing, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:07.439 saber_slash Fluffy_Pillow 76.8/100: 77% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(4), true_bearing, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:08.244 run_through Fluffy_Pillow 72.6/100: 73% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(4), true_bearing, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:09.046 saber_slash Fluffy_Pillow 79.8/100: 80% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(6), true_bearing, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:09.851 run_through Fluffy_Pillow 92.1/100: 92% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(6), true_bearing, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:10.654 marked_for_death Fluffy_Pillow 99.7/100: 100% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(7), true_bearing, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:10.654 run_through Fluffy_Pillow 99.7/100: 100% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(7), true_bearing, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:11.458 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(9), true_bearing, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:12.262 Waiting 0.800 sec 81.1/100: 81% energy | 6.0/6: 100% combo_points bloodlust, raid_movement, adrenaline_rush, opportunity, alacrity(9), true_bearing, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:13.062 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(9), true_bearing, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:13.866 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(10), true_bearing, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:14.673 run_through Fluffy_Pillow 81.6/100: 82% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(10), true_bearing, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:15.478 saber_slash Fluffy_Pillow 90.3/100: 90% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(11), true_bearing, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:16.282 run_through Fluffy_Pillow 82.6/100: 83% energy | 6.0/6: 100% combo_points bloodlust, opportunity, alacrity(11), true_bearing, roll_the_bones, potion_of_the_old_war
0:17.284 vanish Fluffy_Pillow 79.7/100: 80% energy | 1.0/6: 17% combo_points bloodlust, opportunity, alacrity(13), true_bearing, roll_the_bones, potion_of_the_old_war
0:17.284 ambush Fluffy_Pillow 79.7/100: 80% energy | 1.0/6: 17% combo_points bloodlust, opportunity, vanish, alacrity(13), true_bearing, roll_the_bones, potion_of_the_old_war
0:18.289 ghostly_strike Fluffy_Pillow 55.9/100: 56% energy | 3.0/6: 50% combo_points bloodlust, opportunity, alacrity(13), true_bearing, roll_the_bones, hidden_blade, potion_of_the_old_war
0:19.293 pistol_shot Fluffy_Pillow 46.0/100: 46% energy | 4.0/6: 67% combo_points bloodlust, opportunity, alacrity(13), true_bearing, roll_the_bones, hidden_blade, potion_of_the_old_war
0:20.298 blade_flurry Fluffy_Pillow 82.2/100: 82% energy | 5.0/6: 83% combo_points bloodlust, raid_movement, alacrity(13), true_bearing, roll_the_bones, hidden_blade, potion_of_the_old_war
0:20.298 Waiting 2.900 sec 82.2/100: 82% energy | 5.0/6: 83% combo_points bloodlust, raid_movement, blade_flurry, alacrity(13), true_bearing, roll_the_bones, hidden_blade, potion_of_the_old_war
0:23.198 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points bloodlust, blade_flurry, alacrity(13), true_bearing, roll_the_bones, hidden_blade
0:24.201 sprint Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, blade_flurry, opportunity, alacrity(13), true_bearing, roll_the_bones
0:24.201 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, blade_flurry, opportunity, sprint, alacrity(13), true_bearing, roll_the_bones
0:25.205 saber_slash Fluffy_Pillow 95.9/100: 96% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, opportunity, sprint, alacrity(14), true_bearing, roll_the_bones
0:26.209 saber_slash Fluffy_Pillow 80.8/100: 81% energy | 3.0/6: 50% combo_points bloodlust, blade_flurry, opportunity, sprint, alacrity(14), true_bearing, roll_the_bones
0:27.213 pistol_shot Fluffy_Pillow 49.8/100: 50% energy | 4.0/6: 67% combo_points bloodlust, blade_flurry, opportunity, sprint, alacrity(14), true_bearing, roll_the_bones
0:28.220 Waiting 0.400 sec 68.7/100: 69% energy | 5.0/6: 83% combo_points bloodlust, raid_movement, blade_flurry, sprint, alacrity(14), true_bearing, roll_the_bones
0:28.620 saber_slash Fluffy_Pillow 76.3/100: 76% energy | 5.0/6: 83% combo_points bloodlust, blade_flurry, sprint, alacrity(14), true_bearing, roll_the_bones
0:29.625 run_through Fluffy_Pillow 61.2/100: 61% energy | 6.0/6: 100% combo_points bloodlust, blade_flurry, opportunity, sprint, alacrity(14), true_bearing, roll_the_bones
0:30.629 pistol_shot Fluffy_Pillow 57.3/100: 57% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, opportunity, sprint, alacrity(15), true_bearing, roll_the_bones
0:31.635 saber_slash Fluffy_Pillow 76.4/100: 76% energy | 2.0/6: 33% combo_points bloodlust, blade_flurry, sprint, alacrity(15), true_bearing, roll_the_bones
0:32.639 ghostly_strike Fluffy_Pillow 93.5/100: 93% energy | 3.0/6: 50% combo_points bloodlust, blade_flurry, alacrity(15), true_bearing, roll_the_bones
0:33.643 saber_slash Fluffy_Pillow 98.6/100: 99% energy | 4.0/6: 67% combo_points bloodlust, blade_flurry, alacrity(15), true_bearing, roll_the_bones
0:34.648 saber_slash Fluffy_Pillow 67.7/100: 68% energy | 5.0/6: 83% combo_points bloodlust, blade_flurry, alacrity(15), true_bearing, roll_the_bones
0:35.653 roll_the_bones Fluffy_Pillow 52.8/100: 53% energy | 6.0/6: 100% combo_points bloodlust, blade_flurry, opportunity, alacrity(15), true_bearing, roll_the_bones
0:36.657 marked_for_death Fluffy_Pillow_Add1 75.2/100: 75% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, opportunity, alacrity(16), grand_melee, roll_the_bones, blood_frenzy
0:36.657 roll_the_bones Fluffy_Pillow 75.2/100: 75% energy | 6.0/6: 100% combo_points bloodlust, blade_flurry, opportunity, alacrity(16), grand_melee, roll_the_bones, blood_frenzy
0:37.663 saber_slash Fluffy_Pillow 83.2/100: 83% energy | 2.0/6: 33% combo_points bloodlust, blade_flurry, opportunity, alacrity(17), jolly_roger, roll_the_bones, blood_frenzy
0:38.667 saber_slash Fluffy_Pillow 70.1/100: 70% energy | 4.0/6: 67% combo_points bloodlust, blade_flurry, opportunity, alacrity(17), jolly_roger, roll_the_bones, blood_frenzy
0:39.670 adrenaline_rush Fluffy_Pillow 41.1/100: 41% energy | 6.0/6: 100% combo_points bloodlust, blade_flurry, opportunity, alacrity(17), jolly_roger, roll_the_bones, blood_frenzy
0:39.670 roll_the_bones Fluffy_Pillow 41.1/100: 41% energy | 6.0/6: 100% combo_points bloodlust, blade_flurry, adrenaline_rush, opportunity, alacrity(17), jolly_roger, roll_the_bones, blood_frenzy
0:40.476 cancel_buff Fluffy_Pillow 78.3/100: 78% energy | 2.0/6: 33% combo_points bloodlust, blade_flurry, adrenaline_rush, opportunity, alacrity(19), grand_melee, roll_the_bones, blood_frenzy
0:40.476 saber_slash Fluffy_Pillow 78.3/100: 78% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(19), grand_melee, roll_the_bones, blood_frenzy
0:41.282 pistol_shot Fluffy_Pillow 61.9/100: 62% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(19), grand_melee, roll_the_bones, blood_frenzy
0:42.087 roll_the_bones Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(19), grand_melee, roll_the_bones, blood_frenzy
0:42.892 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
0:43.698 saber_slash Fluffy_Pillow 85.7/100: 86% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
0:44.502 Waiting 0.500 sec 71.3/100: 71% energy | 3.0/6: 50% combo_points raid_movement, adrenaline_rush, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
0:45.002 ghostly_strike Fluffy_Pillow 93.4/100: 93% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
0:45.806 saber_slash Fluffy_Pillow 99.1/100: 99% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), buried_treasure, roll_the_bones, blood_frenzy
0:46.611 roll_the_bones Fluffy_Pillow 84.5/100: 85% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), buried_treasure, roll_the_bones
0:47.415 saber_slash Fluffy_Pillow 97.9/100: 98% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
0:48.219 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
0:49.023 saber_slash Fluffy_Pillow 76.4/100: 76% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
0:49.829 pistol_shot Fluffy_Pillow 52.8/100: 53% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
0:50.634 blade_flurry Fluffy_Pillow 79.2/100: 79% energy | 6.0/6: 100% combo_points raid_movement, adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
0:50.634 Waiting 2.500 sec 79.2/100: 79% energy | 6.0/6: 100% combo_points raid_movement, blade_flurry, adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
0:53.134 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
0:53.937 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
0:54.742 saber_slash Fluffy_Pillow 73.5/100: 73% energy | 3.0/6: 50% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
0:55.746 pistol_shot Fluffy_Pillow 38.8/100: 39% energy | 4.0/6: 67% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
0:56.751 saber_slash Fluffy_Pillow 54.1/100: 54% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
0:57.758 run_through Fluffy_Pillow 51.5/100: 51% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
0:58.765 saber_slash Fluffy_Pillow 59.8/100: 60% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
0:59.769 gouge Fluffy_Pillow 25.2/100: 25% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:00.775 Waiting 0.300 sec 56.5/100: 57% energy | 3.0/6: 50% combo_points raid_movement, blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:01.075 ghostly_strike Fluffy_Pillow 61.1/100: 61% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:02.080 saber_slash Fluffy_Pillow 62.4/100: 62% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:03.084 Waiting 0.500 sec 43.7/100: 44% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:03.584 saber_slash Fluffy_Pillow 51.4/100: 51% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:04.589 run_through Fluffy_Pillow 48.7/100: 49% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:05.593 marked_for_death Fluffy_Pillow_Add1 57.0/100: 57% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:05.593 run_through Fluffy_Pillow 57.0/100: 57% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:06.599 pistol_shot Fluffy_Pillow 49.4/100: 49% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:07.603 saber_slash Fluffy_Pillow 80.7/100: 81% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:08.608 pistol_shot Fluffy_Pillow 62.0/100: 62% energy | 4.0/6: 67% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:09.614 saber_slash Fluffy_Pillow 77.4/100: 77% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:10.618 cancel_buff Fluffy_Pillow 42.7/100: 43% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:10.618 run_through Fluffy_Pillow 42.7/100: 43% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:11.622 gouge Fluffy_Pillow 36.1/100: 36% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:12.626 saber_slash Fluffy_Pillow 84.6/100: 85% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:13.631 pistol_shot Fluffy_Pillow 67.1/100: 67% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:14.635 ghostly_strike Fluffy_Pillow 83.6/100: 84% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:15.639 run_through Fluffy_Pillow 70.0/100: 70% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:16.642 Waiting 0.400 sec 63.5/100: 63% energy | 1.0/6: 17% combo_points raid_movement, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:17.042 saber_slash Fluffy_Pillow 70.1/100: 70% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:18.045 Waiting 0.900 sec 36.5/100: 37% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:18.945 saber_slash Fluffy_Pillow 67.3/100: 67% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:19.949 Waiting 0.100 sec 33.7/100: 34% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:20.049 blade_flurry Fluffy_Pillow 35.4/100: 35% energy | 3.0/6: 50% combo_points raid_movement, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:20.049 Waiting 3.100 sec 35.4/100: 35% energy | 3.0/6: 50% combo_points raid_movement, blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:23.149 saber_slash Fluffy_Pillow 82.7/100: 83% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
1:24.153 saber_slash Fluffy_Pillow 65.2/100: 65% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
1:25.158 run_through Fluffy_Pillow 63.8/100: 64% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
1:26.163 pistol_shot Fluffy_Pillow 57.3/100: 57% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
1:27.169 saber_slash Fluffy_Pillow 89.9/100: 90% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
1:28.174 saber_slash Fluffy_Pillow 56.5/100: 56% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
1:29.178 ghostly_strike Fluffy_Pillow 55.0/100: 55% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
1:30.183 run_through Fluffy_Pillow 57.6/100: 58% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
1:31.189 pistol_shot Fluffy_Pillow 51.1/100: 51% energy | 2.0/6: 33% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
1:32.195 Waiting 0.800 sec 67.7/100: 68% energy | 3.0/6: 50% combo_points raid_movement, blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
1:32.995 saber_slash Fluffy_Pillow 80.9/100: 81% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
1:34.000 saber_slash Fluffy_Pillow 63.4/100: 63% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), blood_frenzy
1:35.007 roll_the_bones Fluffy_Pillow 30.0/100: 30% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), blood_frenzy
1:36.011 marked_for_death Fluffy_Pillow_Add1 33.6/100: 34% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, roll_the_bones, blood_frenzy
1:36.011 roll_the_bones Fluffy_Pillow 33.6/100: 34% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), grand_melee, roll_the_bones, blood_frenzy
1:37.015 curse_of_the_dreadblades Fluffy_Pillow 53.1/100: 53% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
1:37.015 saber_slash Fluffy_Pillow 53.1/100: 53% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:38.023 roll_the_bones Fluffy_Pillow 35.7/100: 36% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), jolly_roger, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:39.027 saber_slash Fluffy_Pillow 55.3/100: 55% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:40.032 cancel_buff Fluffy_Pillow 21.8/100: 22% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:40.032 roll_the_bones Fluffy_Pillow 21.8/100: 22% energy | 6.0/6: 100% combo_points alacrity(20), broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:41.037 gouge Fluffy_Pillow 31.1/100: 31% energy | 1.0/6: 17% combo_points alacrity(20), buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:42.040 saber_slash Fluffy_Pillow 69.3/100: 69% energy | 2.0/6: 33% combo_points alacrity(20), buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
1:43.045 roll_the_bones Fluffy_Pillow 41.5/100: 41% energy | 6.0/6: 100% combo_points alacrity(20), buried_treasure, roll_the_bones, curse_of_the_dreadblades
1:44.051 Waiting 0.100 sec 49.1/100: 49% energy | 1.0/6: 17% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
1:44.151 saber_slash Fluffy_Pillow 51.1/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
1:45.156 run_through Fluffy_Pillow 37.7/100: 38% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
1:46.160 pistol_shot Fluffy_Pillow 35.3/100: 35% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
1:47.163 run_through Fluffy_Pillow 55.9/100: 56% energy | 6.0/6: 100% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
1:48.168 Waiting 0.900 sec 69.5/100: 70% energy | 1.0/6: 17% combo_points raid_movement, alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
1:49.068 saber_slash Fluffy_Pillow 88.0/100: 88% energy | 1.0/6: 17% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones
1:50.072 blade_flurry Fluffy_Pillow 74.6/100: 75% energy | 3.0/6: 50% combo_points raid_movement, alacrity(20), broadsides, buried_treasure, roll_the_bones
1:50.072 Waiting 3.100 sec 74.6/100: 75% energy | 3.0/6: 50% combo_points raid_movement, blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones
1:53.172 ghostly_strike Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones
1:54.176 run_through Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones
1:55.182 vanish Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones
1:55.182 ambush Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, vanish, alacrity(20), broadsides, buried_treasure, roll_the_bones
1:56.186 saber_slash Fluffy_Pillow 91.1/100: 91% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones, hidden_blade
1:57.190 run_through Fluffy_Pillow 76.3/100: 76% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones
1:58.193 saber_slash Fluffy_Pillow 88.4/100: 88% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones
1:59.198 saber_slash Fluffy_Pillow 57.6/100: 58% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones
2:00.202 sprint Fluffy_Pillow 43.1/100: 43% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:00.202 run_through Fluffy_Pillow 43.1/100: 43% energy | 5.0/6: 83% combo_points blade_flurry, sprint, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:01.207 gouge Fluffy_Pillow 40.8/100: 41% energy | 1.0/6: 17% combo_points blade_flurry, sprint, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:02.212 saber_slash Fluffy_Pillow 61.5/100: 62% energy | 3.0/6: 50% combo_points blade_flurry, sprint, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:03.217 run_through Fluffy_Pillow 32.2/100: 32% energy | 5.0/6: 83% combo_points blade_flurry, sprint, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:04.221 Waiting 0.800 sec 29.9/100: 30% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, sprint, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:05.021 marked_for_death Fluffy_Pillow_Add1 46.4/100: 46% energy | 1.0/6: 17% combo_points blade_flurry, sprint, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:05.021 run_through Fluffy_Pillow 46.4/100: 46% energy | 6.0/6: 100% combo_points blade_flurry, sprint, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:06.025 Waiting 0.300 sec 44.1/100: 44% energy | 2.0/6: 33% combo_points blade_flurry, sprint, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:06.325 saber_slash Fluffy_Pillow 50.2/100: 50% energy | 2.0/6: 33% combo_points blade_flurry, sprint, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:07.331 Waiting 0.196 sec 21.0/100: 21% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, sprint, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:07.527 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, sprint, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:08.530 pistol_shot Fluffy_Pillow 38.6/100: 39% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:09.535 ghostly_strike Fluffy_Pillow 75.3/100: 75% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:10.539 cancel_buff Fluffy_Pillow 66.0/100: 66% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:10.539 run_through Fluffy_Pillow 66.0/100: 66% energy | 5.0/6: 83% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:11.543 saber_slash Fluffy_Pillow 65.3/100: 65% energy | 1.0/6: 17% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:12.547 gouge Fluffy_Pillow 37.5/100: 37% energy | 3.0/6: 50% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:13.552 run_through Fluffy_Pillow 75.7/100: 76% energy | 5.0/6: 83% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:14.557 saber_slash Fluffy_Pillow 75.0/100: 75% energy | 1.0/6: 17% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:15.560 Waiting 0.200 sec 47.2/100: 47% energy | 3.0/6: 50% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:15.760 saber_slash Fluffy_Pillow 51.6/100: 52% energy | 3.0/6: 50% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:16.763 run_through Fluffy_Pillow 23.8/100: 24% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:17.768 pistol_shot Fluffy_Pillow 23.1/100: 23% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:18.773 saber_slash Fluffy_Pillow 61.4/100: 61% energy | 3.0/6: 50% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:19.777 run_through Fluffy_Pillow 49.2/100: 49% energy | 5.0/6: 83% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones
2:20.781 blade_flurry Fluffy_Pillow 46.8/100: 47% energy | 1.0/6: 17% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones
2:20.781 Waiting 0.200 sec 46.8/100: 47% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones
2:20.981 saber_slash Fluffy_Pillow 50.6/100: 51% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones
2:21.984 run_through Fluffy_Pillow 35.7/100: 36% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
2:22.988 pistol_shot Fluffy_Pillow 31.9/100: 32% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
2:23.992 ghostly_strike Fluffy_Pillow 51.3/100: 51% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:24.997 run_through Fluffy_Pillow 42.0/100: 42% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:26.001 gouge Fluffy_Pillow 39.6/100: 40% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:27.005 saber_slash Fluffy_Pillow 60.3/100: 60% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:28.009 run_through Fluffy_Pillow 47.0/100: 47% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:29.012 saber_slash Fluffy_Pillow 60.6/100: 61% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:30.017 run_through Fluffy_Pillow 47.3/100: 47% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:31.021 saber_slash Fluffy_Pillow 61.0/100: 61% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:32.026 run_through Fluffy_Pillow 31.7/100: 32% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:33.030 pistol_shot Fluffy_Pillow 45.4/100: 45% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:34.035 saber_slash Fluffy_Pillow 82.1/100: 82% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:35.040 roll_the_bones Fluffy_Pillow 68.8/100: 69% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
2:36.044 marked_for_death Fluffy_Pillow_Add1 100.0/100: 100% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:36.044 Waiting 1.000 sec 100.0/100: 100% energy | 6.0/6: 100% combo_points raid_movement, blade_flurry, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:37.044 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:38.048 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:39.052 pistol_shot Fluffy_Pillow 66.5/100: 67% energy | 2.0/6: 33% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:40.057 cancel_buff Fluffy_Pillow 99.1/100: 99% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:40.057 ghostly_strike Fluffy_Pillow 99.1/100: 99% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:41.062 saber_slash Fluffy_Pillow 86.9/100: 87% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
2:42.068 saber_slash Fluffy_Pillow 54.0/100: 54% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones
2:43.070 run_through Fluffy_Pillow 52.4/100: 52% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones
2:44.075 gouge Fluffy_Pillow 45.9/100: 46% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones
2:45.081 saber_slash Fluffy_Pillow 62.4/100: 62% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones
2:46.085 Waiting 1.300 sec 28.9/100: 29% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones
2:47.385 saber_slash Fluffy_Pillow 50.2/100: 50% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones
2:48.389 Waiting 1.106 sec 16.7/100: 17% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones
2:49.495 saber_slash Fluffy_Pillow 50.8/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones
2:50.500 blade_flurry Fluffy_Pillow 65.3/100: 65% energy | 6.0/6: 100% combo_points raid_movement, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones
2:50.500 Waiting 2.100 sec 65.3/100: 65% energy | 6.0/6: 100% combo_points raid_movement, blade_flurry, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones
2:52.600 run_through Fluffy_Pillow 97.4/100: 97% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones
2:53.603 marked_for_death Fluffy_Pillow_Add1 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones
2:53.603 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones
2:54.607 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones
2:55.611 adrenaline_rush Fluffy_Pillow 81.3/100: 81% energy | 2.0/6: 33% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones
2:55.611 potion Fluffy_Pillow 81.3/100: 81% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones
2:55.611 vanish Fluffy_Pillow 81.3/100: 81% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, potion_of_the_old_war
2:55.611 ambush Fluffy_Pillow 81.3/100: 81% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, opportunity, vanish, alacrity(20), grand_melee, true_bearing, roll_the_bones, potion_of_the_old_war
2:56.616 ghostly_strike Fluffy_Pillow 52.0/100: 52% energy | 4.0/6: 67% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, hidden_blade, potion_of_the_old_war
2:57.420 pistol_shot Fluffy_Pillow 62.5/100: 63% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, hidden_blade, potion_of_the_old_war
2:58.225 run_through Fluffy_Pillow 87.1/100: 87% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, true_bearing, roll_the_bones, hidden_blade, potion_of_the_old_war
2:59.030 saber_slash Fluffy_Pillow 88.6/100: 89% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, true_bearing, roll_the_bones, hidden_blade, potion_of_the_old_war
2:59.837 saber_slash Fluffy_Pillow 95.3/100: 95% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, true_bearing, roll_the_bones, potion_of_the_old_war
3:00.641 saber_slash Fluffy_Pillow 69.8/100: 70% energy | 4.0/6: 67% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, true_bearing, roll_the_bones, potion_of_the_old_war
3:01.445 saber_slash Fluffy_Pillow 76.3/100: 76% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, true_bearing, roll_the_bones, potion_of_the_old_war
3:02.248 sprint Fluffy_Pillow 50.8/100: 51% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, potion_of_the_old_war
3:02.248 run_through Fluffy_Pillow 50.8/100: 51% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, potion_of_the_old_war
3:03.054 pistol_shot Fluffy_Pillow 68.4/100: 68% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, potion_of_the_old_war
3:03.858 saber_slash Fluffy_Pillow 93.0/100: 93% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, potion_of_the_old_war
3:04.664 ghostly_strike Fluffy_Pillow 69.0/100: 69% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy, potion_of_the_old_war
3:05.469 saber_slash Fluffy_Pillow 65.5/100: 66% energy | 4.0/6: 67% combo_points blade_flurry, adrenaline_rush, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy, potion_of_the_old_war
3:06.274 run_through Fluffy_Pillow 42.1/100: 42% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy, potion_of_the_old_war
3:07.078 marked_for_death Fluffy_Pillow_Add1 45.6/100: 46% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy, potion_of_the_old_war
3:07.078 run_through Fluffy_Pillow 45.6/100: 46% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy, potion_of_the_old_war
3:07.884 curse_of_the_dreadblades Fluffy_Pillow 65.1/100: 65% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy, potion_of_the_old_war
3:07.884 pistol_shot Fluffy_Pillow 65.1/100: 65% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:08.690 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:09.495 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:10.299 cancel_buff Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:10.299 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:11.103 saber_slash Fluffy_Pillow 96.8/100: 97% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:12.109 run_through Fluffy_Pillow 80.6/100: 81% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:13.113 saber_slash Fluffy_Pillow 75.4/100: 75% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:14.116 run_through Fluffy_Pillow 43.1/100: 43% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:15.121 pistol_shot Fluffy_Pillow 37.9/100: 38% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:16.126 run_through Fluffy_Pillow 55.8/100: 56% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:17.130 saber_slash Fluffy_Pillow 66.5/100: 67% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:18.135 roll_the_bones Fluffy_Pillow 34.3/100: 34% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:19.139 saber_slash Fluffy_Pillow 55.1/100: 55% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
3:20.143 blade_flurry Fluffy_Pillow 38.9/100: 39% energy | 6.0/6: 100% combo_points raid_movement, alacrity(20), grand_melee, roll_the_bones, blood_frenzy, potion_of_the_old_war
3:20.143 roll_the_bones Fluffy_Pillow 38.9/100: 39% energy | 6.0/6: 100% combo_points raid_movement, blade_flurry, alacrity(20), grand_melee, roll_the_bones, blood_frenzy, potion_of_the_old_war
3:21.148 Waiting 1.200 sec 42.4/100: 42% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, alacrity(20), shark_infested_waters, roll_the_bones
3:22.348 vanish Fluffy_Pillow 60.7/100: 61% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, alacrity(20), shark_infested_waters, roll_the_bones
3:22.348 Waiting 0.800 sec 60.7/100: 61% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, vanish, alacrity(20), shark_infested_waters, roll_the_bones
3:23.148 ambush Fluffy_Pillow 72.9/100: 73% energy | 1.0/6: 17% combo_points blade_flurry, vanish, alacrity(20), shark_infested_waters, roll_the_bones
3:24.151 Waiting 0.900 sec 29.5/100: 29% energy | 3.0/6: 50% combo_points raid_movement, blade_flurry, alacrity(20), shark_infested_waters, roll_the_bones, hidden_blade, blood_frenzy
3:25.051 ghostly_strike Fluffy_Pillow 44.3/100: 44% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), shark_infested_waters, roll_the_bones, hidden_blade, blood_frenzy
3:26.055 gouge Fluffy_Pillow 46.8/100: 47% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), shark_infested_waters, roll_the_bones, hidden_blade, blood_frenzy
3:27.059 sprint Fluffy_Pillow 63.4/100: 63% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), shark_infested_waters, roll_the_bones, hidden_blade, blood_frenzy
3:27.059 roll_the_bones Fluffy_Pillow 63.4/100: 63% energy | 5.0/6: 83% combo_points blade_flurry, sprint, alacrity(20), shark_infested_waters, roll_the_bones, hidden_blade, blood_frenzy
3:28.065 saber_slash Fluffy_Pillow 66.9/100: 67% energy | 1.0/6: 17% combo_points blade_flurry, sprint, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, hidden_blade, blood_frenzy
3:29.070 run_through Fluffy_Pillow 49.5/100: 49% energy | 5.0/6: 83% combo_points blade_flurry, sprint, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
3:30.074 Waiting 0.500 sec 43.0/100: 43% energy | 1.0/6: 17% combo_points blade_flurry, sprint, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
3:30.574 saber_slash Fluffy_Pillow 51.3/100: 51% energy | 1.0/6: 17% combo_points blade_flurry, sprint, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
3:31.579 Waiting 2.035 sec 17.8/100: 18% energy | 3.0/6: 50% combo_points blade_flurry, sprint, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
3:33.614 saber_slash Fluffy_Pillow 50.8/100: 51% energy | 3.0/6: 50% combo_points blade_flurry, sprint, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:34.618 Waiting 0.582 sec 16.1/100: 16% energy | 5.0/6: 83% combo_points blade_flurry, sprint, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:35.200 run_through Fluffy_Pillow 41.0/100: 41% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:36.205 marked_for_death Fluffy_Pillow_Add1 33.3/100: 33% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:36.205 run_through Fluffy_Pillow 33.3/100: 33% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:37.207 gouge Fluffy_Pillow 41.6/100: 42% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:38.210 ghostly_strike Fluffy_Pillow 56.9/100: 57% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:39.213 run_through Fluffy_Pillow 42.2/100: 42% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:40.218 cancel_buff Fluffy_Pillow 34.5/100: 35% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:40.218 Waiting 1.000 sec 34.5/100: 35% energy | 1.0/6: 17% combo_points raid_movement, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:41.218 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:42.223 run_through Fluffy_Pillow 49.4/100: 49% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:43.226 pistol_shot Fluffy_Pillow 58.9/100: 59% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:44.231 saber_slash Fluffy_Pillow 75.4/100: 75% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:45.236 run_through Fluffy_Pillow 73.9/100: 74% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:46.241 saber_slash Fluffy_Pillow 83.3/100: 83% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:47.247 pistol_shot Fluffy_Pillow 49.8/100: 50% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:48.251 run_through Fluffy_Pillow 66.3/100: 66% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:49.255 saber_slash Fluffy_Pillow 59.8/100: 60% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:50.260 blade_flurry Fluffy_Pillow 58.3/100: 58% energy | 5.0/6: 83% combo_points raid_movement, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:50.260 Waiting 2.900 sec 58.3/100: 58% energy | 5.0/6: 83% combo_points raid_movement, blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:53.160 run_through Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:54.164 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
3:55.167 run_through Fluffy_Pillow 81.9/100: 82% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
3:56.171 Waiting 0.900 sec 91.5/100: 91% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
3:57.071 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
3:58.076 run_through Fluffy_Pillow 98.6/100: 99% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
3:59.081 saber_slash Fluffy_Pillow 92.1/100: 92% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:00.085 ghostly_strike Fluffy_Pillow 90.7/100: 91% energy | 3.0/6: 50% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:01.088 run_through Fluffy_Pillow 77.2/100: 77% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:02.094 saber_slash Fluffy_Pillow 86.8/100: 87% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:03.099 run_through Fluffy_Pillow 85.3/100: 85% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:04.103 saber_slash Fluffy_Pillow 78.9/100: 79% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:05.108 saber_slash Fluffy_Pillow 77.4/100: 77% energy | 3.0/6: 50% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:06.113 run_through Fluffy_Pillow 43.7/100: 44% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:07.116 marked_for_death Fluffy_Pillow_Add1 36.0/100: 36% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:07.116 run_through Fluffy_Pillow 36.0/100: 36% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:08.121 adrenaline_rush Fluffy_Pillow 28.4/100: 28% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:08.121 pistol_shot Fluffy_Pillow 28.4/100: 28% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:08.925 saber_slash Fluffy_Pillow 68.9/100: 69% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:09.730 run_through Fluffy_Pillow 43.4/100: 43% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:10.536 cancel_buff Fluffy_Pillow 61.0/100: 61% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:10.536 saber_slash Fluffy_Pillow 61.0/100: 61% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:11.339 ghostly_strike Fluffy_Pillow 37.4/100: 37% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:12.143 roll_the_bones Fluffy_Pillow 33.8/100: 34% energy | 5.0/6: 83% combo_points raid_movement, adrenaline_rush, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:12.949 Waiting 0.100 sec 47.2/100: 47% energy | 1.0/6: 17% combo_points raid_movement, adrenaline_rush, alacrity(20), broadsides, roll_the_bones
4:13.049 saber_slash Fluffy_Pillow 50.5/100: 50% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), broadsides, roll_the_bones
4:13.854 roll_the_bones Fluffy_Pillow 26.9/100: 27% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), broadsides, roll_the_bones
4:14.658 pistol_shot Fluffy_Pillow 40.3/100: 40% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, roll_the_bones
4:15.463 saber_slash Fluffy_Pillow 66.7/100: 67% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), jolly_roger, roll_the_bones
4:16.266 pistol_shot Fluffy_Pillow 43.0/100: 43% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, roll_the_bones
4:17.071 roll_the_bones Fluffy_Pillow 85.4/100: 85% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), jolly_roger, roll_the_bones
4:17.876 saber_slash Fluffy_Pillow 98.9/100: 99% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), broadsides, roll_the_bones
4:18.680 roll_the_bones Fluffy_Pillow 91.2/100: 91% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), broadsides, roll_the_bones
4:19.484 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:20.286 blade_flurry Fluffy_Pillow 76.3/100: 76% energy | 3.0/6: 50% combo_points raid_movement, adrenaline_rush, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:20.286 Waiting 2.900 sec 76.3/100: 76% energy | 3.0/6: 50% combo_points raid_movement, blade_flurry, adrenaline_rush, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:23.186 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:24.190 run_through Fluffy_Pillow 81.3/100: 81% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:25.193 saber_slash Fluffy_Pillow 73.6/100: 74% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:26.197 run_through Fluffy_Pillow 54.9/100: 55% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:27.200 pistol_shot Fluffy_Pillow 47.2/100: 47% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:28.203 Waiting 0.800 sec 62.5/100: 63% energy | 3.0/6: 50% combo_points raid_movement, blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:29.003 ghostly_strike Fluffy_Pillow 74.7/100: 75% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:30.009 run_through Fluffy_Pillow 76.1/100: 76% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:31.014 saber_slash Fluffy_Pillow 68.4/100: 68% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:32.019 gouge Fluffy_Pillow 49.8/100: 50% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:33.026 run_through Fluffy_Pillow 65.1/100: 65% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:34.031 saber_slash Fluffy_Pillow 73.5/100: 73% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:35.035 ghostly_strike Fluffy_Pillow 38.8/100: 39% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:36.039 run_through Fluffy_Pillow 40.1/100: 40% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:37.043 marked_for_death Fluffy_Pillow_Add1 33.6/100: 34% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:37.043 run_through Fluffy_Pillow 33.6/100: 34% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:38.048 curse_of_the_dreadblades Fluffy_Pillow 43.2/100: 43% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, blood_frenzy
4:38.048 Waiting 0.500 sec 43.2/100: 43% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:38.548 saber_slash Fluffy_Pillow 51.4/100: 51% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:39.554 Waiting 0.425 sec 18.0/100: 18% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:39.979 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:40.985 cancel_buff Fluffy_Pillow 18.6/100: 19% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:40.985 Waiting 0.862 sec 18.6/100: 19% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:41.847 gouge Fluffy_Pillow 33.8/100: 34% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:43.024 saber_slash Fluffy_Pillow 54.7/100: 55% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:44.029 Waiting 1.041 sec 22.5/100: 22% energy | 6.0/6: 100% combo_points raid_movement, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:45.070 run_through Fluffy_Pillow 40.9/100: 41% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:46.075 pistol_shot Fluffy_Pillow 51.7/100: 52% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
4:47.079 run_through Fluffy_Pillow 84.2/100: 84% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
4:48.084 saber_slash Fluffy_Pillow 77.7/100: 78% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
4:49.089 run_through Fluffy_Pillow 44.1/100: 44% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades
4:50.095 blade_flurry Fluffy_Pillow 53.6/100: 54% energy | 1.0/6: 17% combo_points raid_movement, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:50.095 pistol_shot Fluffy_Pillow 53.6/100: 54% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:51.100 Waiting 2.100 sec 69.0/100: 69% energy | 3.0/6: 50% combo_points raid_movement, blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:53.200 ghostly_strike Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:54.204 run_through Fluffy_Pillow 85.3/100: 85% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:55.209 saber_slash Fluffy_Pillow 93.6/100: 94% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:56.213 saber_slash Fluffy_Pillow 59.0/100: 59% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:57.217 run_through Fluffy_Pillow 24.3/100: 24% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:58.221 gouge Fluffy_Pillow 16.6/100: 17% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
4:59.225 Waiting 1.800 sec 31.9/100: 32% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
5:01.025 saber_slash Fluffy_Pillow 59.4/100: 59% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
5:02.030 run_through Fluffy_Pillow 40.7/100: 41% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
5:03.034 pistol_shot Fluffy_Pillow 33.0/100: 33% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
5:04.038 saber_slash Fluffy_Pillow 64.3/100: 64% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
5:05.042 roll_the_bones Fluffy_Pillow 29.7/100: 30% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), shark_infested_waters, broadsides, roll_the_bones
5:06.046 marked_for_death Fluffy_Pillow_Add1 32.0/100: 32% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones
5:06.046 run_through Fluffy_Pillow 32.0/100: 32% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones
5:07.052 Waiting 0.700 sec 24.3/100: 24% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones
5:07.752 saber_slash Fluffy_Pillow 51.0/100: 51% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones
5:08.756 sprint Fluffy_Pillow 16.9/100: 17% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:08.756 gouge Fluffy_Pillow 16.9/100: 17% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, sprint, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:09.760 run_through Fluffy_Pillow 33.5/100: 33% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, sprint, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:10.765 cancel_buff Fluffy_Pillow 43.0/100: 43% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, sprint, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:10.765 pistol_shot Fluffy_Pillow 43.0/100: 43% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:11.770 ghostly_strike Fluffy_Pillow 60.8/100: 61% energy | 3.0/6: 50% combo_points sprint, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:12.775 run_through Fluffy_Pillow 48.6/100: 49% energy | 5.0/6: 83% combo_points sprint, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:13.779 Waiting 0.400 sec 43.4/100: 43% energy | 1.0/6: 17% combo_points sprint, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:14.179 saber_slash Fluffy_Pillow 50.5/100: 51% energy | 1.0/6: 17% combo_points sprint, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:15.184 saber_slash Fluffy_Pillow 50.3/100: 50% energy | 3.0/6: 50% combo_points sprint, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:16.188 Waiting 0.489 sec 18.1/100: 18% energy | 6.0/6: 100% combo_points raid_movement, opportunity, sprint, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:16.677 run_through Fluffy_Pillow 26.8/100: 27% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:17.682 pistol_shot Fluffy_Pillow 21.6/100: 22% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:18.687 saber_slash Fluffy_Pillow 54.8/100: 55% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones
5:19.690 run_through Fluffy_Pillow 37.3/100: 37% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones
5:20.694 pistol_shot Fluffy_Pillow 30.7/100: 31% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones
5:21.699 gouge Fluffy_Pillow 47.2/100: 47% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones
5:22.702 run_through Fluffy_Pillow 63.7/100: 64% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones
5:23.708 saber_slash Fluffy_Pillow 57.2/100: 57% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones
5:24.712 run_through Fluffy_Pillow 23.6/100: 24% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones
5:25.717 pistol_shot Fluffy_Pillow 33.1/100: 33% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones
5:26.721 ghostly_strike Fluffy_Pillow 50.9/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:27.726 run_through Fluffy_Pillow 54.7/100: 55% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:28.729 Waiting 0.100 sec 49.5/100: 49% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:28.829 saber_slash Fluffy_Pillow 51.3/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:29.834 Waiting 0.335 sec 19.1/100: 19% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:30.169 adrenaline_rush Fluffy_Pillow 25.0/100: 25% energy | 3.0/6: 50% combo_points alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:30.169 Waiting 0.300 sec 25.0/100: 25% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:30.469 saber_slash Fluffy_Pillow 51.6/100: 52% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:31.275 run_through Fluffy_Pillow 30.2/100: 30% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:32.079 pistol_shot Fluffy_Pillow 35.7/100: 36% energy | 1.0/6: 17% combo_points raid_movement, adrenaline_rush, opportunity, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:32.883 vanish Fluffy_Pillow 96.2/100: 96% energy | 3.0/6: 50% combo_points raid_movement, adrenaline_rush, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:32.883 Waiting 0.200 sec 96.2/100: 96% energy | 3.0/6: 50% combo_points raid_movement, adrenaline_rush, vanish, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:33.083 ambush Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points adrenaline_rush, vanish, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:34.088 run_through Fluffy_Pillow 75.6/100: 76% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, hidden_blade, blood_frenzy
5:34.893 saber_slash Fluffy_Pillow 81.1/100: 81% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, hidden_blade, blood_frenzy
5:35.699 sprint Fluffy_Pillow 91.7/100: 92% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:35.699 run_through Fluffy_Pillow 91.7/100: 92% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones, blood_frenzy
5:36.504 saber_slash Fluffy_Pillow 95.1/100: 95% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones
5:37.309 run_through Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones
5:38.113 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones
5:38.917 ghostly_strike Fluffy_Pillow 76.4/100: 76% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones
5:39.722 roll_the_bones Fluffy_Pillow 88.8/100: 89% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), shark_infested_waters, true_bearing, broadsides, roll_the_bones
5:40.527 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
5:41.330 saber_slash Fluffy_Pillow 78.5/100: 78% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
5:42.134 saber_slash Fluffy_Pillow 88.9/100: 89% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
5:42.939 run_through Fluffy_Pillow 99.5/100: 99% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
5:43.745 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
5:44.549 saber_slash Fluffy_Pillow 94.5/100: 94% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
5:45.355 saber_slash Fluffy_Pillow 69.7/100: 70% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
5:46.360 pistol_shot Fluffy_Pillow 53.6/100: 54% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
5:47.366 saber_slash Fluffy_Pillow 87.4/100: 87% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
5:48.372 Waiting 0.700 sec 71.2/100: 71% energy | 6.0/6: 100% combo_points raid_movement, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
5:49.072 run_through Fluffy_Pillow 83.6/100: 84% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
5:50.076 saber_slash Fluffy_Pillow 78.2/100: 78% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:51.082 pistol_shot Fluffy_Pillow 60.7/100: 61% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:52.086 saber_slash Fluffy_Pillow 77.1/100: 77% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:53.092 run_through Fluffy_Pillow 59.6/100: 60% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:54.099 saber_slash Fluffy_Pillow 53.2/100: 53% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:55.104 gouge Fluffy_Pillow 35.6/100: 36% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:56.108 ghostly_strike Fluffy_Pillow 52.1/100: 52% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:57.112 saber_slash Fluffy_Pillow 54.6/100: 55% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:58.116 Waiting 0.800 sec 37.0/100: 37% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:58.916 saber_slash Fluffy_Pillow 50.2/100: 50% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:59.922 run_through Fluffy_Pillow 32.7/100: 33% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
6:00.926 pistol_shot Fluffy_Pillow 26.1/100: 26% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
6:01.931 saber_slash Fluffy_Pillow 58.6/100: 59% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
6:02.934 Waiting 0.600 sec 25.1/100: 25% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
6:03.534 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
6:04.539 Waiting 0.462 sec 17.4/100: 17% energy | 5.0/6: 83% combo_points raid_movement, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
6:05.001 gouge Fluffy_Pillow 25.0/100: 25% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
6:06.107 run_through Fluffy_Pillow 59.1/100: 59% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
6:07.111 saber_slash Fluffy_Pillow 52.6/100: 53% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
6:08.115 ghostly_strike Fluffy_Pillow 51.1/100: 51% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
6:09.119 pistol_shot Fluffy_Pillow 53.5/100: 54% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
6:10.123 saber_slash Fluffy_Pillow 86.0/100: 86% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
6:11.126 run_through Fluffy_Pillow 68.5/100: 68% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
6:12.129 curse_of_the_dreadblades Fluffy_Pillow 61.9/100: 62% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
6:12.129 pistol_shot Fluffy_Pillow 61.9/100: 62% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
6:13.135 run_through Fluffy_Pillow 78.4/100: 78% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
6:14.140 saber_slash Fluffy_Pillow 71.9/100: 72% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
6:15.143 roll_the_bones Fluffy_Pillow 38.4/100: 38% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
6:16.146 saber_slash Fluffy_Pillow 61.9/100: 62% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, curse_of_the_dreadblades
6:17.151 run_through Fluffy_Pillow 48.5/100: 49% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, curse_of_the_dreadblades
6:18.156 pistol_shot Fluffy_Pillow 46.2/100: 46% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, curse_of_the_dreadblades
6:19.160 run_through Fluffy_Pillow 82.7/100: 83% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, curse_of_the_dreadblades
6:20.165 Waiting 0.900 sec 96.3/100: 96% energy | 1.0/6: 17% combo_points raid_movement, alacrity(20), grand_melee, buried_treasure, roll_the_bones, curse_of_the_dreadblades
6:21.065 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, curse_of_the_dreadblades
6:22.070 run_through Fluffy_Pillow 72.3/100: 72% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:23.075 saber_slash Fluffy_Pillow 71.5/100: 72% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:24.079 run_through Fluffy_Pillow 59.7/100: 60% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:25.083 saber_slash Fluffy_Pillow 59.0/100: 59% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
6:26.088 ghostly_strike Fluffy_Pillow 31.2/100: 31% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
6:27.093 pistol_shot Fluffy_Pillow 23.5/100: 23% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
6:28.097 gouge Fluffy_Pillow 45.7/100: 46% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
6:29.103 run_through Fluffy_Pillow 84.0/100: 84% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
6:30.108 saber_slash Fluffy_Pillow 99.2/100: 99% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
6:31.112 saber_slash Fluffy_Pillow 71.5/100: 71% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
6:32.116 saber_slash Fluffy_Pillow 59.7/100: 60% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8805 8480 0
Agility 25492 23786 13626 (8132)
Stamina 31123 31123 19786
Intellect 5323 4998 0
Spirit 5 5 0
Health 1867380 1867380 0
Energy 100 100 0
Combo Points 6 6 0
Crit 28.80% 28.80% 4831
Haste 13.92% 13.92% 4524
Damage / Heal Versatility 4.80% 3.86% 1546
Attack Power 38238 35679 0
Mastery 56.72% 56.72% 6223
Armor 2045 2045 2045
Run Speed 8 0 0
Leech 3.42% 3.42% 786

Gear

Source Slot Average Item Level: 855.00
Local Head Magic-Warped Hood
ilevel: 860, stats: { 276 Armor, +2136 Sta, +1424 AgiInt, +939 Mastery, +416 Crit }
Local Neck Brysngamen, Torc of Helheim
ilevel: 845, stats: { +1045 Sta, +1287 Mastery, +514 Vers }, gems: { +150 Vers }
Local Shoulders Biornskin Shoulderpads
ilevel: 830, stats: { 231 Armor, +807 AgiInt, +1211 Sta, +532 Crit, +376 Mastery, +389 Leech }
Local Shirt Rich Purple Silk Shirt
ilevel: 1
Local Chest Scarred Ragefang Chestpiece
ilevel: 850, stats: { 329 Armor, +1945 Sta, +1297 AgiInt, +820 Mastery, +484 Haste }
Local Waist Forest-Lord's Waistwrap
ilevel: 850, stats: { 185 Armor, +1459 Sta, +973 AgiInt, +637 Haste, +342 Mastery }
Local Legs Splotched Bloodfur Leggings
ilevel: 850, stats: { 288 Armor, +1945 Sta, +1297 AgiInt, +932 Crit, +372 Mastery }
Local Feet Thraxi's Tricksy Treads
ilevel: 895, stats: { 263 Armor, +2219 Sta, +1479 Agi, +745 Crit, +413 Mastery }
Local Wrists Biornskin Bracer
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +479 Crit, +227 Mastery }
Local Hands Dreamsculptor's Gloves
ilevel: 850, stats: { 206 Armor, +1459 Sta, +973 AgiInt, +615 Haste, +363 Crit }
Local Finger1 Dreadful Cyclopean Signet
ilevel: 850, stats: { +1094 Sta, +997 Haste, +839 Mastery }
Local Finger2 Band of Fused Coral
ilevel: 845, stats: { +1045 Sta, +1287 Haste, +514 Crit }
Local Trinket1 An'she's Token of Guile
ilevel: 835, stats: { +1073 Agi, +397 Leech, +882 Vers }
Local Trinket2 Bloodthirsty Instinct
ilevel: 870, stats: { +1486 Agi }
Local Back Goldscar Pelt
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +216 Crit, +504 Haste }
Local Main Hand The Dreadblades
ilevel: 879, weapon: { 4318 - 8020, 2.6 }, stats: { +728 Agi, +1093 Sta, +317 Crit, +304 Mastery }, relics: { +43 ilevels, +43 ilevels, +43 ilevels }
Local Off Hand The Dreadblades
ilevel: 879, weapon: { 4318 - 8020, 2.6 }, stats: { +728 Agi, +1093 Sta, +317 Crit, +304 Mastery }

Talents

Level
15 Ghostly Strike (Outlaw Rogue) Swordmaster (Outlaw Rogue) Quick Draw (Outlaw Rogue)
30 Grappling Hook (Outlaw Rogue) Acrobatic Strikes (Outlaw Rogue) Hit and Run (Outlaw Rogue)
45 Deeper Stratagem Anticipation Vigor
60 Iron Stomach (Outlaw Rogue) Elusiveness Cheat Death
75 Parley (Outlaw Rogue) Prey on the Weak Dirty Tricks (Outlaw Rogue)
90 Cannonball Barrage (Outlaw Rogue) Alacrity Killing Spree (Outlaw Rogue)
100 Slice and Dice (Outlaw Rogue) Marked for Death Death from Above

Profile

rogue="Vait"
origin="https://us.api.battle.net/wow/character/thrall/Vait/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/196/133742276-avatar.jpg"
level=110
race=undead
role=attack
position=back
professions=skinning=800/herbalism=114
talents=1113322
artifact=44:0:0:0:0:1052:1:1054:1:1056:1:1057:1:1060:3:1061:3:1063:3:1064:3:1065:1:1066:3:1348:1
spec=outlaw

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
actions.precombat+=/roll_the_bones,if=!talent.slice_and_dice.enabled

# Executed every time the actor is available.
# Condition to continue rerolling RtB (2- or not TB alone or not SIW alone during CDs); If SnD: consider that you never have to reroll.
actions=variable,name=rtb_reroll,value=!talent.slice_and_dice.enabled&(rtb_buffs<=1&!rtb_list.any.6&((!buff.curse_of_the_dreadblades.up&!buff.adrenaline_rush.up)|!rtb_list.any.5))
# Condition to use Saber Slash when not rerolling RtB or when using SnD
actions+=/variable,name=ss_useable_noreroll,value=(combo_points<5+talent.deeper_stratagem.enabled-(buff.broadsides.up|buff.jolly_roger.up)-(talent.alacrity.enabled&buff.alacrity.stack<=4))
# Condition to use Saber Slash, when you have RtB or not
actions+=/variable,name=ss_useable,value=(talent.anticipation.enabled&combo_points<4)|(!talent.anticipation.enabled&((variable.rtb_reroll&combo_points<4+talent.deeper_stratagem.enabled)|(!variable.rtb_reroll&variable.ss_useable_noreroll)))
# Normal rotation
actions+=/call_action_list,name=bf
actions+=/call_action_list,name=cds
# Conditions are here to avoid worthless check if nothing is available
actions+=/call_action_list,name=stealth,if=stealthed|cooldown.vanish.up|cooldown.shadowmeld.up
actions+=/death_from_above,if=energy.time_to_max>2&!variable.ss_useable_noreroll
actions+=/slice_and_dice,if=!variable.ss_useable&buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
actions+=/roll_the_bones,if=!variable.ss_useable&buff.roll_the_bones.remains<target.time_to_die&(buff.roll_the_bones.remains<=3|variable.rtb_reroll)
actions+=/killing_spree,if=energy.time_to_max>5|energy<15
actions+=/call_action_list,name=build
actions+=/call_action_list,name=finish,if=!variable.ss_useable
# Gouge is used as a CP Generator while nothing else is available and you have Dirty Tricks talent. It's unlikely that you'll be able to do this optimally in-game since it requires to move in front of the target, but it's here so you can quantifiy its value.
actions+=/gouge,if=talent.dirty_tricks.enabled&combo_points.deficit>=1

# Blade Flurry
actions.bf=cancel_buff,name=blade_flurry,if=equipped.shivarran_symmetry&cooldown.blade_flurry.up&buff.blade_flurry.up&spell_targets.blade_flurry>=2|spell_targets.blade_flurry<2&buff.blade_flurry.up
actions.bf+=/blade_flurry,if=spell_targets.blade_flurry>=2&!buff.blade_flurry.up

# Builders
actions.build=ghostly_strike,if=combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
actions.build+=/pistol_shot,if=combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&energy.time_to_max>2-talent.quick_draw.enabled
actions.build+=/saber_slash,if=variable.ss_useable

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.adrenaline_rush.up
actions.cds+=/blood_fury
actions.cds+=/berserking
actions.cds+=/arcane_torrent,if=energy.deficit>40
actions.cds+=/cannonball_barrage,if=spell_targets.cannonball_barrage>=1
actions.cds+=/adrenaline_rush,if=!buff.adrenaline_rush.up&energy.deficit>0
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15)&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.cds+=/sprint,if=equipped.thraxis_tricksy_treads&!variable.ss_useable
actions.cds+=/curse_of_the_dreadblades,if=combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)

# Finishers
actions.finish=between_the_eyes,if=equipped.greenskins_waterlogged_wristcuffs&buff.shark_infested_waters.up
actions.finish+=/run_through,if=!talent.death_from_above.enabled|energy.time_to_max<cooldown.death_from_above.remains+3.5

# Stealth
# Condition to use stealth abilities
actions.stealth=variable,name=stealth_condition,value=(combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&!debuff.ghostly_strike.up)+buff.broadsides.up&energy>60&!buff.jolly_roger.up&!buff.hidden_blade.up&!buff.curse_of_the_dreadblades.up)
actions.stealth+=/ambush
actions.stealth+=/vanish,if=variable.stealth_condition
actions.stealth+=/shadowmeld,if=variable.stealth_condition

head=magicwarped_hood,id=141453,bonus_id=1472
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727/1808/1497/3336,gems=150vers
shoulders=biornskin_shoulderpads,id=134198,bonus_id=3397/41/1492/1675
back=goldscar_pelt,id=133639,bonus_id=1726/1497/3337
chest=scarred_ragefang_chestpiece,id=139208,bonus_id=1807/1472
shirt=rich_purple_silk_shirt,id=4335
wrists=biornskin_bracer,id=134192,bonus_id=3432/1502/3336
hands=dreamsculptors_gloves,id=139202,bonus_id=1807/1472
waist=forestlords_waistwrap,id=139198,bonus_id=1807/1808/1472
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1807/1472
feet=thraxis_tricksy_treads,id=137031,bonus_id=1811
finger1=dreadful_cyclopean_signet,id=139237,bonus_id=1807/1472
finger2=band_of_fused_coral,id=134532,bonus_id=1727/1497/3336
trinket1=anshes_token_of_guile,id=139113,bonus_id=3432/41/607/1497/1674
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1492/3337
main_hand=the_dreadblades,id=128872,bonus_id=742,gem_id=137302/139261/137270/0,relic_id=3410:1502:3336/1807:1472/3410:1502:3336/0
off_hand=the_dreadblades,id=134552

# Gear Summary
# gear_ilvl=854.56
# gear_agility=13626
# gear_stamina=19786
# gear_crit_rating=4831
# gear_haste_rating=4524
# gear_mastery_rating=6223
# gear_versatility_rating=1546
# gear_leech_rating=786
# gear_armor=2045

Bowflexn

Bowflexn : 494378 dps, 347528 dps to main target

  • Race: Tauren
  • Class: Shaman
  • Spec: Enhancement
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
494378.1 494378.1 585.7 / 0.118% 114259.2 / 23.1% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 3.38% 57.8 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Bowflexn/advanced
Talents
  • 15: Boulderfist (Enhancement Shaman)
  • 30: Wind Rush Totem
  • 45: Lightning Surge Totem
  • 60: Hailstorm (Enhancement Shaman)
  • 75: Tempest (Enhancement Shaman)
  • 90: Crashing Storm (Enhancement Shaman)
  • 100: Landslide (Enhancement Shaman)
  • Talent Calculator
Artifact
Professions
  • leatherworking: 800
  • enchanting: 131
Scale Factors for Bowflexn Damage Per Second
Mastery Agi Haste Vers Crit
Scale Factors 16.72 15.80 13.06 11.91 10.97
Normalized 1.06 1.00 0.83 0.75 0.69
Scale Deltas 1138 1138 1138 1138 1138
Error 0.74 0.74 0.74 0.73 0.74
Gear Ranking
Optimizers
Ranking
  • Mastery > Agi > Haste > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=15.80, CritRating=10.97, HasteRating=13.06, MasteryRating=16.72, Versatility=11.91 )

Scale Factors for other metrics

Scale Factors for Bowflexn Damage Per Second
Mastery Agi Haste Vers Crit
Scale Factors 16.72 15.80 13.06 11.91 10.97
Normalized 1.06 1.00 0.83 0.75 0.69
Scale Deltas 1138 1138 1138 1138 1138
Error 0.74 0.74 0.74 0.73 0.74
Gear Ranking
Optimizers
Ranking
  • Mastery > Agi > Haste > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=15.80, CritRating=10.97, HasteRating=13.06, MasteryRating=16.72, Versatility=11.91 )
Scale Factors for Bowflexn Priority Target Damage Per Second
Agi Mastery Haste Vers Crit
Scale Factors 11.03 10.65 9.50 8.26 7.59
Normalized 1.00 0.97 0.86 0.75 0.69
Scale Deltas 1138 1138 1138 1138 1138
Error 0.38 0.37 0.38 0.37 0.38
Gear Ranking
Optimizers
Ranking
  • Agi ~= Mastery > Haste > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=11.03, CritRating=7.59, HasteRating=9.50, MasteryRating=10.65, Versatility=8.26 )
Scale Factors for Bowflexn Damage Per Second (Effective)
Mastery Agi Haste Vers Crit
Scale Factors 16.72 15.80 13.06 11.91 10.97
Normalized 1.06 1.00 0.83 0.75 0.69
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Mastery > Agi > Haste > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=15.80, CritRating=10.97, HasteRating=13.06, MasteryRating=16.72, Versatility=11.91 )
Scale Factors for Bowflexn Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for BowflexnTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Bowflexn 494378
Boulderfist 35603 7.3% 77.5 5.19sec 184305 157280 Direct 77.5 138478 282553 184305 31.8% 0.0%  

Stats details: boulderfist

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.47 77.47 0.00 0.00 1.1718 0.0000 14277840.17 14277840.17 0.00 157279.58 157279.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.83 68.19% 138478.48 130505 160164 138474.70 135968 144101 7315578 7315578 0.00
crit 24.64 31.81% 282553.20 266231 326734 282545.64 276410 297894 6962262 6962262 0.00
 
 

Action details: boulderfist

Static Values
  • id:201897
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.boulderfist.remains<gcd&maelstrom>=50&active_enemies>=3
Spelldata
  • id:201897
  • name:Boulderfist
  • school:nature
  • tooltip:
  • description:Slams your target with the power of stone, dealing {$s1=1} Nature damage and enhancing your weapons for {$218825d=10 seconds}, increasing your critical strike chance by {$218825s1=5}% and all damage you deal by {$218825s2=5}%. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Crash Lightning 38804 (77692) 7.8% (15.6%) 64.9 6.11sec 474012 406784 Direct 261.3 44160 90082 58828 31.9% 0.0%  

Stats details: crash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.94 261.30 0.00 0.00 1.1653 0.0000 15371781.01 15371781.01 0.00 406784.04 406784.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 177.83 68.06% 44159.97 39235 51032 44159.87 43352 45906 7853138 7853138 0.00
crit 83.46 31.94% 90082.28 80040 104104 90082.96 88617 93479 7518643 7518643 0.00
 
 

Action details: crash_lightning

Static Values
  • id:187874
  • school:nature
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.alpha_wolf.rank&prev_gcd.feral_spirit
Spelldata
  • id:187874
  • name:Crash Lightning
  • school:nature
  • tooltip:Stormstrike and Lava Lash deal an additional $195592sw1 damage to all targets in front of you.
  • description:Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Crashing Storm 38889 7.8% 403.1 0.98sec 38233 0 Direct 1680.9 6876 14028 9168 32.0% 0.0%  

Stats details: crashing_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 403.08 1680.94 0.00 0.00 0.0000 0.0000 15410787.75 15410787.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1142.34 67.96% 6876.36 5990 7939 6876.37 6776 7134 7855119 7855119 0.00
crit 538.60 32.04% 14028.29 12219 16196 14028.46 13806 14565 7555668 7555668 0.00
 
 

Action details: crashing_storm

Static Values
  • id:210801
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210801
  • name:Crashing Storm
  • school:nature
  • tooltip:
  • description:{$@spelldesc192246=Crash Lightning also electrifies the ground, leaving an electrical field behind which damages enemies within it for ${6*{$210801s1=1}} Nature damage over {$210797d=6 seconds}. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.140000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Flametongue 6725 (29229) 1.4% (5.9%) 30.4 13.27sec 384423 330333 Direct 30.4 66564 135787 88784 32.1% 0.0%  

Stats details: flametongue

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.36 30.36 0.00 0.00 1.1638 0.0000 2695663.90 2695663.90 0.00 330332.84 330332.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.62 67.90% 66563.76 65776 76880 66563.95 65776 69867 1372318 1372318 0.00
crit 9.75 32.10% 135786.59 134182 156835 135775.27 134182 148340 1323346 1323346 0.00
 
 

Action details: flametongue

Static Values
  • id:193796
  • school:fire
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.flametongue.remains<gcd
Spelldata
  • id:193796
  • name:Flametongue
  • school:fire
  • tooltip:
  • description:Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.200000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Flametongue Attack 22504 4.6% 1096.5 1.15sec 8187 0 Direct 1096.5 6141 12528 8187 32.0% 0.0%  

Stats details: flametongue_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1096.45 1096.45 0.00 0.00 0.0000 0.0000 8976316.53 8976316.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 745.31 67.97% 6141.14 5348 7089 6141.06 6048 6319 4577075 4577075 0.00
crit 351.14 32.03% 12528.41 10911 14461 12528.45 12347 12921 4399242 4399242 0.00
 
 

Action details: flametongue_attack

Static Values
  • id:10444
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Frostbrand 4184 (59688) 0.9% (12.1%) 24.5 16.56sec 971155 828043 Direct 24.5 51292 104627 68341 32.0% 0.0%  

Stats details: frostbrand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.53 24.53 102.34 0.00 1.1728 3.7145 1676171.19 1676171.19 0.00 58250.45 828042.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.69 68.04% 51292.27 50702 59262 51291.57 50702 54982 855931 855931 0.00
crit 7.84 31.96% 104626.61 103433 120894 104586.63 0 120894 820241 820241 0.00
 
 

Action details: frostbrand

Static Values
  • id:196834
  • school:frost
  • resource:maelstrom
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.hailstorm.enabled&buff.frostbrand.remains<gcd
Spelldata
  • id:196834
  • name:Frostbrand
  • school:frost
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.925000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.00
  • base_tick_time:5.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Hailstorm 55504 11.2% 1073.7 1.18sec 20622 0 Direct 1073.7 15473 31568 20622 32.0% 0.0%  

Stats details: hailstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1073.75 1073.75 0.00 0.00 0.0000 0.0000 22143312.06 22143312.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 730.23 68.01% 15473.34 13732 17861 15473.13 15247 15922 11299130 11299130 0.00
crit 343.52 31.99% 31567.87 28014 36437 31567.78 31105 32585 10844182 10844182 0.00
 
 

Action details: hailstorm

Static Values
  • id:210854
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210854
  • name:Hailstorm
  • school:frost
  • tooltip:
  • description:{$@spelldesc210853=Frostbrand now also enhances your weapon's damage, causing each of your weapon attacks to also deal $210854sw1 Frost damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.35
 
Lava Lash 6204 (11109) 1.3% (2.3%) 16.8 22.80sec 263859 232453 Direct 16.8 111512 227518 148540 31.9% 0.0%  

Stats details: lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.81 16.81 0.00 0.00 1.1351 0.0000 2496815.13 2496815.13 0.00 232452.65 232452.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.44 68.08% 111512.10 110244 128855 111522.73 110244 123537 1276108 1276108 0.00
crit 5.37 31.92% 227517.65 224897 262863 225700.34 0 262863 1220707 1220707 0.00
 
 

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.hot_hand.react
Spelldata
  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing $sw1 Fire damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.05
 
    Crash Lightning (lava_lash_cl) 4905 1.0% 8.0 29.56sec 241998 0 Direct 32.9 44152 90060 58830 32.0% 0.0%  

Stats details: lava_lash_cl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.01 32.95 0.00 0.00 0.0000 0.0000 1938381.42 1938381.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.42 68.03% 44151.78 43661 51032 43979.92 0 51032 989674 989674 0.00
crit 10.53 31.97% 90060.02 89068 104104 89126.22 0 104104 948708 948708 0.00
 
 

Action details: lava_lash_cl

Static Values
  • id:195592
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:195592
  • name:Crash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc187874=Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you. }
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
main_hand 9730 2.0% 166.1 2.42sec 23484 12963 Direct 166.1 20559 41954 23484 32.0% 19.0%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 166.06 166.06 0.00 0.00 1.8116 0.0000 3899739.85 5732986.97 31.98 12963.44 12963.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.37 49.00% 20558.59 18480 20587 20558.13 20452 20587 1672762 2459119 31.98
crit 53.08 31.96% 41954.40 37698 41998 41953.84 41649 41998 2226978 3273868 31.98
miss 31.61 19.04% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Mark of the Hidden Satyr 11552 2.3% 24.5 16.31sec 188472 0 Direct 24.5 141487 288773 188474 31.9% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.54 24.54 0.00 0.00 0.0000 0.0000 4625536.24 4625536.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.71 68.10% 141487.12 129354 163791 141478.14 137439 154919 2364706 2364706 0.00
crit 7.83 31.90% 288773.08 263883 334133 288755.92 0 334133 2260830 2260830 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
offhand 4854 1.0% 165.5 2.42sec 11756 6473 Direct 165.5 10283 20983 11756 32.0% 19.0%  

Stats details: offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 165.50 165.50 0.00 0.00 1.8162 0.0000 1945593.57 2860206.84 31.98 6473.08 6473.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.21 49.07% 10283.16 9240 10294 10282.99 10217 10294 835068 1227630 31.98
crit 52.92 31.98% 20983.19 18849 20999 20982.99 20852 20999 1110525 1632577 31.98
miss 31.36 18.95% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: offhand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Potion of the Old War 8990 1.8% 21.5 7.29sec 165438 0 Direct 21.5 124290 253734 165438 31.8% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.46 21.46 0.00 0.00 0.0000 0.0000 3550323.06 5219311.19 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.64 68.21% 124290.20 118740 124677 124286.60 122896 124677 1819406 2674700 31.98
crit 6.82 31.79% 253734.04 242230 254342 253624.87 0 254342 1730917 2544611 31.96
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Storm Tempests 4171 0.8% 175.3 1.65sec 9393 0 Direct 175.3 7049 14381 9393 32.0% 0.0%  

Stats details: storm_tempests

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 175.34 175.34 0.00 0.00 0.0000 0.0000 1647039.16 1647039.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 119.28 68.03% 7049.01 6252 8141 7048.92 6940 7346 840816 840816 0.00
crit 56.06 31.97% 14381.14 12754 16607 14381.21 14124 15168 806223 806223 0.00
 
 

Action details: storm_tempests

Static Values
  • id:214452
  • school:nature
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:214452
  • name:Storm Tempests
  • school:nature
  • tooltip:
  • description:{$@spelldesc214260=Enemies hit by your Stormstrike become lightning charged for {$s1=15} sec, zapping a nearby enemy every $214265t1 sec for $214452sw1 Nature damage.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.15
 
Stormlash 15583 3.2% 526.0 1.82sec 11862 0 Direct 526.0 11862 0 11862 0.0% 0.0%  

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 526.03 526.03 0.00 0.00 0.0000 0.0000 6240046.11 6240046.11 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 526.03 100.00% 11862.49 1226 74456 11868.16 10525 13676 6240046 6240046 0.00
 
 

Action details: stormlash

Static Values
  • id:213307
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:213307
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:1.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:23790.00
  • base_dd_max:23790.00
 
Stormstrike 0 (155519) 0.0% (31.4%) 112.5 3.51sec 549558 472143

Stats details: stormstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.49 0.00 0.00 0.00 1.1640 0.0000 0.00 0.00 0.00 472142.94 472142.94
 
 

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:16.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3&!talent.hailstorm.enabled
Spelldata
  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Crash Lightning (stormstrike_cl) 54544 10.9% 81.6 3.58sec 263836 0 Direct 365.2 44237 90236 58952 32.0% 0.0%  

Stats details: stormstrike_cl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.61 365.23 0.00 0.00 0.0000 0.0000 21531065.17 21531065.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 248.39 68.01% 44236.66 43661 51032 44236.45 43661 46198 10987966 10987966 0.00
crit 116.84 31.99% 90236.21 89068 104104 90236.47 89068 94754 10543099 10543099 0.00
 
 

Action details: stormstrike_cl

Static Values
  • id:195592
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:195592
  • name:Crash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc187874=Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you. }
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Stormstrike (_mh) 67305 13.6% 140.6 3.51sec 190981 0 Direct 140.6 143279 292069 190985 32.1% 0.0%  

Stats details: stormstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.62 140.62 0.00 0.00 0.0000 0.0000 26855696.45 39480417.62 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 95.54 67.94% 143279.49 50176 213250 143571.06 123760 163992 13688276 20123063 31.98
crit 45.08 32.06% 292069.21 102360 435029 292663.71 223017 349748 13167420 19357355 31.98
 
 

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.00
 
    Stormstrike Off-Hand 33670 6.8% 140.6 3.51sec 95543 0 Direct 140.6 71624 146101 95542 32.1% 0.0%  

Stats details: stormstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.62 140.62 0.00 0.00 0.0000 0.0000 13435162.82 19750961.96 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 95.46 67.88% 71624.36 25088 106625 71772.13 62139 81774 6837105 10051192 31.98
crit 45.16 32.12% 146101.13 51180 217515 146385.04 115617 178170 6598058 9699770 31.98
 
 

Action details: stormstrike_offhand

Static Values
  • id:32176
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.00
 
Unleash Lava 9060 1.8% 69.3 8.57sec 52175 0 Direct 69.0 39338 80256 52445 32.0% 0.0%  

Stats details: unleash_lava

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.32 68.97 0.00 0.00 0.0000 0.0000 3617016.43 3617016.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.87 67.97% 39337.74 38806 45357 39336.54 38806 42082 1843915 1843915 0.00
crit 22.09 32.03% 80255.52 79165 92529 80257.13 79165 88520 1773102 1773102 0.00
 
 

Action details: unleash_lava

Static Values
  • id:199053
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199053
  • name:Unleash Lava
  • school:fire
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Unleash Lightning 9034 1.8% 69.1 8.58sec 52221 0 Direct 68.7 39339 80256 52492 32.1% 0.0%  

Stats details: unleash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.07 68.71 0.00 0.00 0.0000 0.0000 3606690.83 3606690.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.62 67.86% 39339.30 38806 45357 39338.46 38806 42181 1834147 1834147 0.00
crit 22.09 32.14% 80255.64 79165 92529 80256.94 79165 87517 1772543 1772543 0.00
 
 

Action details: unleash_lightning

Static Values
  • id:199054
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199054
  • name:Unleash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Windfury Attack 22410 4.5% 273.6 3.56sec 32648 0 Direct 273.6 24499 49993 32649 32.0% 0.0%  

Stats details: windfury_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 273.61 273.61 0.00 0.00 0.0000 0.0000 8932824.75 13132098.52 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 186.14 68.03% 24499.32 16700 55752 24498.55 20354 31128 4560228 6703967 31.98
crit 87.47 31.97% 49993.09 34068 113733 49991.86 39615 63940 4372597 6428131 31.98
 
 

Action details: windfury_attack

Static Values
  • id:25504
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Each of your main hand attacks has a {$33757h=20}% chance to trigger two extra attacks, dealing $25504sw2 Physical damage each.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
Windfury Attack (_oh) 2708 0.6% 29.2 26.76sec 37134 0 Direct 29.2 27875 56865 37134 31.9% 0.0%  

Stats details: windfury_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.17 29.17 0.00 0.00 0.0000 0.0000 1083154.92 1592340.32 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.85 68.06% 27874.95 25050 27876 27874.98 27499 27876 553409 813564 31.98
crit 9.32 31.94% 56865.09 51102 56867 56853.69 0 56867 529746 778776 31.97
 
 

Action details: windfury_attack_oh

Static Values
  • id:33750
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:33750
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:$@spelldesc8232
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
pet - frost_wolf 235573 / 11930
Frozen Bite 86069 0.9% 9.4 35.84sec 185593 0 Direct 9.4 140388 280833 185587 32.2% 0.0%  

Stats details: frozen_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.41 9.41 0.00 0.00 0.0000 0.0000 1746799.07 1746799.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.38 67.81% 140387.63 128323 161986 139849.83 0 161986 896038 896038 0.00
crit 3.03 32.19% 280832.85 256646 323971 262617.81 0 323971 850761 850761 0.00
 
 

Action details: frozen_bite

Static Values
  • id:224126
  • school:frost
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224126
  • name:Frozen Bite
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Bite the target, causing {$s1=1} Frost damage and slowing the target's movement speed by {$s2=50}% for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
melee 52144 0.5% 45.4 6.74sec 23174 23106 Direct 45.4 17537 35080 23174 32.1% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.44 45.44 0.00 0.00 1.0029 0.0000 1053073.92 1548118.41 31.98 23106.39 23106.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.84 67.87% 17536.51 16256 17556 17536.53 17231 17556 540845 795094 31.98
crit 14.60 32.13% 35080.46 32511 35112 35045.22 0 35112 512228 753024 31.94
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Snowstorm 97360 1.0% 15.5 19.34sec 127043 0 Direct 39.8 37431 74878 49421 32.0% 0.0%  

Stats details: snowstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.49 39.81 0.00 0.00 0.0000 0.0000 1967334.50 1967334.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.06 67.98% 37430.85 34219 43196 37273.51 0 43196 1013002 1013002 0.00
crit 12.75 32.02% 74877.72 68438 86391 73875.41 0 86391 954333 954333 0.00
 
 

Action details: snowstorm

Static Values
  • id:198483
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198483
  • name:Snowstorm
  • school:frost
  • tooltip:
  • description:Deals {$s1=0} Frost damage to all targets within $A1 yards.
 
pet - fiery_wolf 273557 / 14047
Fiery Jaws 125379 1.3% 9.5 36.13sec 272653 0 Direct 9.5 93587 187151 123699 32.2% 0.0%  
Periodic 37.8 37437 0 37437 0.0% 0.0% 9.4%

Stats details: fiery_jaws

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.49 9.49 37.75 37.75 0.0000 1.0000 2587102.68 2587102.68 0.00 68528.89 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.43 67.82% 93587.33 85549 107991 93191.08 0 107991 602211 602211 0.00
crit 3.05 32.18% 187151.09 171098 215982 175245.04 0 215982 571544 571544 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.8 100.00% 37437.12 34221 43198 37405.14 0 42678 1413347 1413347 0.00
 
 

Action details: fiery_jaws

Static Values
  • id:224125
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224125
  • name:Fiery Jaws
  • school:fire
  • tooltip:Suffering {$s2=1} Fire damage every $t sec.
  • description:Bite the target for {$s1=1} Fire damage, causing an additional $o2 Fire damage over {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fire Nova 96748 1.0% 15.7 19.49sec 126335 0 Direct 40.0 37421 74838 49459 32.2% 0.0%  

Stats details: fire_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.65 39.98 0.00 0.00 0.0000 0.0000 1977459.00 1977459.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.12 67.83% 37421.46 34219 43196 37290.46 0 43196 1014781 1014781 0.00
crit 12.86 32.17% 74837.56 68438 86391 73931.19 0 86391 962678 962678 0.00
 
 

Action details: fire_nova

Static Values
  • id:198480
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198480
  • name:Fire Nova
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to all targets within $A1 yards.
 
melee 51430 0.5% 45.8 6.76sec 23159 23073 Direct 45.8 17536 35080 23159 32.1% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.77 45.77 0.00 0.00 1.0037 0.0000 1059968.42 1558253.99 31.98 23072.89 23072.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.10 67.95% 17535.54 16256 17556 17531.24 0 17556 545343 801706 31.97
crit 14.67 32.05% 35079.79 32511 35112 35057.65 0 35112 514625 756548 31.96
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lightning_wolf 177101 / 9179
melee 73259 0.8% 46.9 6.21sec 32385 32390 Direct 46.9 24523 49062 32385 32.0% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.92 46.92 0.00 0.00 0.9998 0.0000 1519502.38 2233812.43 31.98 32390.48 32390.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.89 67.96% 24522.55 16256 26334 24522.75 0 26334 781968 1149568 31.97
crit 15.03 32.04% 49062.05 32511 52668 49041.73 0 52668 737534 1084245 31.95
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Thunder Bite 103841 1.1% 15.7 19.29sec 137012 0 Direct 35.3 46051 92071 60831 32.1% 0.0%  

Stats details: thunder_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.68 35.32 0.00 0.00 0.0000 0.0000 2148719.79 2148719.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.98 67.89% 46050.59 24247 64794 46464.05 0 64794 1104268 1104268 0.00
crit 11.34 32.11% 92071.10 48495 129587 91927.64 0 129587 1044452 1044452 0.00
 
 

Action details: thunder_bite

Static Values
  • id:198485
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198485
  • name:Thunder Bite
  • school:nature
  • tooltip:
  • description:Deals {$s1=0} Nature damage, jumping to up to $x targets.
 
Simple Action Stats Execute Interval
Bowflexn
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bowflexn
  • harmful:false
  • if_expr:
 
Doom Winds 6.9 62.34sec

Stats details: doom_winds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: doom_winds

Static Values
  • id:204945
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:204945
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
 
Feral Spirit 3.8 120.37sec

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.77 0.00 0.00 0.00 1.2041 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: feral_spirit

Static Values
  • id:51533
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects$?a231723[ and grant you {$190185s1=5} Maelstrom each time they attack][].
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bowflexn
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bowflexn
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Wind Shear 14.4 28.32sec

Stats details: wind_shear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.40 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: wind_shear

Static Values
  • id:57994
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57994
  • name:Wind Shear
  • school:nature
  • tooltip:
  • description:Disrupts the target's concentration with a burst of wind, interrupting spellcasting and preventing any spell in that school from being cast for {$d=3 seconds}.
 
pet - lightning_wolf
Crackling Surge 9.6 35.75sec

Stats details: crackling_surge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crackling_surge

Static Values
  • id:224127
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224127
  • name:Crackling Surge
  • school:nature
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Frenzy 14.3 8.5 28.1sec 17.3sec 45.88% 45.88% 8.5(8.5) 13.9

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2743.21

Stack Uptimes

  • blood_frenzy_1:45.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 11.55% 0.0(0.0) 1.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Boulderfist 2.3 75.2 105.4sec 5.2sec 99.49% 98.39% 75.2(75.2) 1.3

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_boulderfist
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • boulderfist_1:99.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:218825
  • name:Boulderfist
  • tooltip:Critical strike chance increased by {$s1=5}%. Damage dealt increased by {$s2=5}%.
  • description:{$@spelldesc201897=Slams your target with the power of stone, dealing {$s1=1} Nature damage and enhancing your weapons for {$218825d=10 seconds}, increasing your critical strike chance by {$218825s1=5}% and all damage you deal by {$218825s2=5}%. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Crash Lightning 10.0 29.3 30.0sec 7.4sec 61.19% 70.13% 29.3(29.3) 10.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_crash_lightning
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • crash_lightning_1:61.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187878
  • name:Crash Lightning
  • tooltip:Stormstrike and Lava Lash deal an additional $195592sw1 damage to all targets in front of you.
  • description:{$@spelldesc187874=Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Dirge of Angerboda 3.8 0.0 79.9sec 79.9sec 7.51% 7.51% 0.0(0.0) 3.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_dirge_of_angerboda
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:4534.14

Stack Uptimes

  • dirge_of_angerboda_1:7.51%

Trigger Attempt Success

  • trigger_pct:98.48%

Spelldata details

  • id:214807
  • name:Dirge of Angerboda
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc214798=Your melee attacks have a chance to activate Screams of the Dead, granting you a random combat enhancement for {$214807d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Doom Winds 6.9 0.0 62.3sec 62.3sec 10.20% 12.00% 0.0(0.0) 6.8

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • doom_winds_1:10.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204945
  • name:Doom Winds
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:60.00
  • default_chance:0.00%
Flametongue 4.0 26.3 91.0sec 13.3sec 96.65% 96.59% 45.7(45.7) 3.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_flametongue
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • flametongue_1:96.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194084
  • name:Flametongue
  • tooltip:Each of your weapon attacks causes up to ${$<coeff>*$AP} additional Fire damage.
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Frostbrand 6.7 17.8 55.4sec 16.6sec 95.33% 94.82% 53.4(53.4) 5.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_frostbrand
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frostbrand_1:95.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196834
  • name:Frostbrand
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storms 45.2 19.7 8.8sec 6.1sec 46.63% 39.97% 19.7(19.7) 0.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_gathering_storms
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • gathering_storms_1:46.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198300
  • name:Gathering Storms
  • tooltip:Damage of Stormstrike increased by $w1%.
  • description:{$@spelldesc198299=Each target hit by Crash Lightning increases damage dealt by your next Stormstrike within {$198300d=12 seconds} by {$s1=2}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Howl of Ingvar 3.7 0.0 80.1sec 80.1sec 7.37% 7.37% 0.0(0.0) 3.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_howl_of_ingvar
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:4534.14

Stack Uptimes

  • howl_of_ingvar_1:7.37%

Trigger Attempt Success

  • trigger_pct:98.47%

Spelldata details

  • id:214802
  • name:Howl of Ingvar
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc214798=Your melee attacks have a chance to activate Screams of the Dead, granting you a random combat enhancement for {$214807d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Landslide 2.3 75.2 105.4sec 5.2sec 99.49% 97.75% 75.2(75.2) 1.3

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_landslide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • landslide_1:99.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202004
  • name:Landslide
  • tooltip:Agility increased by {$s1=8}%.
  • description:{$@spelldesc197992={$?s201897=false}[Boulderfist][Rockbiter] now also enhances your weapon, increasing your Agility by {$202004s1=8}% for {$202004d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 121.8sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.53% 14.53% 2.0(2.0) 0.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Stormbringer 41.0 16.9 9.5sec 6.7sec 34.76% 72.69% 23.3(44.4) 0.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_stormbringer
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormbringer_1:14.60%
  • stormbringer_2:20.16%

Trigger Attempt Success

  • trigger_pct:84.57%

Spelldata details

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike has no cooldown and its cost is reduced by {$s3=50}%.
  • description:{$@spelldesc201845=Each of your main hand attacks has a {$h=5}% chance to reset the remaining cooldown on Stormstrike, and cause your next Stormstrike to cost {$201846s3=50}% less Maelstrom and trigger no cooldown.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Stormlash 18.2 11.0 22.2sec 13.7sec 47.16% 47.16% 11.0(11.0) 17.8

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormlash_1:47.16%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:195222
  • name:Stormlash
  • tooltip:Empowered with lightning. Attacks and spellcasts have a chance to deal additional Nature damage.
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Unleash Doom 17.8 10.3 21.8sec 13.6sec 33.18% 40.10% 10.3(10.3) 17.6

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_unleash_doom
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • unleash_doom_1:33.18%

Trigger Attempt Success

  • trigger_pct:20.00%

Spelldata details

  • id:199055
  • name:Unleash Doom
  • tooltip:Your special attacks will trugger an arc of fiery or lightning damage at your target.
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Wail of Svala 3.8 0.0 80.7sec 80.6sec 7.43% 7.43% 0.0(0.0) 3.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_wail_of_svala
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:4534.14

Stack Uptimes

  • wail_of_svala_1:7.43%

Trigger Attempt Success

  • trigger_pct:98.57%

Spelldata details

  • id:214803
  • name:Wail of Svala
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc214798=Your melee attacks have a chance to activate Screams of the Dead, granting you a random combat enhancement for {$214807d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Wind Strikes 36.3 32.2 10.8sec 5.6sec 35.53% 53.97% 32.2(32.2) 36.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_wind_strikes
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.77

Stack Uptimes

  • wind_strikes_1:35.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198293
  • name:Wind Strikes
  • tooltip:Attack speed increased by $w1%.
  • description:{$@spelldesc198292=When Stormbringer resets the remaining cooldown on Stormstrike, you gain {$s1=10}% attack speed for {$198293d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.7 2.0 143.0sec 38.9sec 73.07% 73.07% 9.8(9.8) 0.2

Buff details

  • buff initial source:Bowflexn_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.07%

Trigger Attempt Success

  • trigger_pct:99.20%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.7 2.0 144.7sec 39.6sec 73.16% 73.16% 9.8(9.8) 0.2

Buff details

  • buff initial source:Bowflexn_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.16%

Trigger Attempt Success

  • trigger_pct:99.19%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.7 2.1 143.9sec 39.3sec 73.05% 73.05% 9.9(9.9) 0.2

Buff details

  • buff initial source:Bowflexn_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.05%

Trigger Attempt Success

  • trigger_pct:99.20%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.7 2.1 142.2sec 39.3sec 72.93% 72.93% 9.8(9.8) 0.2

Buff details

  • buff initial source:Bowflexn_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:72.93%

Trigger Attempt Success

  • trigger_pct:99.03%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.7 2.1 143.3sec 39.5sec 73.37% 73.37% 9.9(9.9) 0.2

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.37%

Trigger Attempt Success

  • trigger_pct:99.33%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.7 2.1 142.5sec 39.3sec 73.30% 73.30% 9.9(9.9) 0.2

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.30%

Trigger Attempt Success

  • trigger_pct:99.29%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.8 0.0 30.6sec 30.6sec 76.37% 69.01% 0.0(0.0) 3.2

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.37%

Trigger Attempt Success

  • trigger_pct:99.90%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.8 0.0 30.5sec 30.5sec 76.31% 68.93% 0.0(0.0) 3.2

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.31%

Trigger Attempt Success

  • trigger_pct:99.85%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Wind Shear16.5850.00137.174218.284143.246304.459
Feral Spirit0.4990.0011.2321.0320.0003.260
Crash Lightning1.5170.00155.60792.44137.362171.782
Boulderfist2.0930.0017.34141.91511.39982.307
Stormstrike2.5400.00121.190326.150163.586521.927
Flametongue4.2020.00135.926116.94356.445188.931
Doom Winds2.6260.00141.36413.6190.35555.786

Resources

Resource Usage Type Count Total Average RPE APR
Bowflexn
crash_lightning Maelstrom 64.9 1298.8 20.0 20.0 23700.4
frostbrand Maelstrom 24.5 490.5 20.0 20.0 48557.4
lava_lash Maelstrom 16.8 504.3 30.0 30.0 8794.8
stormstrike Maelstrom 140.6 2862.5 20.4 25.4 21597.2
Resource Gains Type Count Total Average Overflow
Windfury Attack Maelstrom 302.78 1485.02 (28.47%) 4.90 28.86 1.91%
Main Hand Maelstrom 134.45 667.19 (12.79%) 4.96 5.05 0.75%
Off-Hand Maelstrom 134.13 664.23 (12.73%) 4.95 6.43 0.96%
Feral Spirit Maelstrom 107.86 502.01 (9.62%) 4.65 37.26 6.91%
Boulderfist Maelstrom 77.47 1897.69 (36.38%) 24.50 39.03 2.02%
Resource RPS-Gain RPS-Loss
Maelstrom 13.02 12.87
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 59.42 0.00 150.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Flametongue: Windfury Attack 295.0 3.6sec
Frostbrand: Windfury Attack 288.8 3.6sec
Maelstrom Weapon: Windfury Attack 302.8 3.5sec
Stormbringer: Windfury Attack 23.2 17.5sec
Flametongue: main_hand 128.4 3.1sec
Frostbrand: main_hand 126.0 3.2sec
Maelstrom Weapon: main_hand 134.4 3.0sec
Stormbringer: main_hand 11.4 32.8sec
Windfury: main_hand 42.8 9.3sec
Flametongue: offhand 128.5 3.1sec
Frostbrand: offhand 126.2 3.2sec
Maelstrom Weapon: offhand 134.1 3.0sec
Windfury: offhand 14.6 26.7sec
Flametongue: Crash Lightning 256.2 6.2sec
Frostbrand: Crash Lightning 250.6 6.3sec
Stormbringer: Crash Lightning 22.1 18.6sec
Windfury: Crash Lightning 61.1 9.9sec
Flametongue: Stormstrike 135.8 3.6sec
Frostbrand: Stormstrike 132.7 3.7sec
Stormbringer: Stormstrike 11.9 30.4sec
Windfury: Stormstrike 33.0 12.3sec
Unleash Doom: Stormstrike 69.2 6.8sec
Flametongue: Stormstrike Off-Hand 135.8 3.6sec
Frostbrand: Stormstrike Off-Hand 132.7 3.7sec
Unleash Doom: Stormstrike Off-Hand 69.2 6.8sec
Flametongue: Lava Lash 16.8 22.7sec
Frostbrand: Lava Lash 16.8 22.7sec

Statistics & Data Analysis

Fight Length
Sample Data Bowflexn Fight Length
Count 9999
Mean 400.62
Minimum 307.54
Maximum 499.01
Spread ( max - min ) 191.47
Range [ ( max - min ) / 2 * 100% ] 23.90%
DPS
Sample Data Bowflexn Damage Per Second
Count 9999
Mean 494378.05
Minimum 411753.96
Maximum 611158.11
Spread ( max - min ) 199404.14
Range [ ( max - min ) / 2 * 100% ] 20.17%
Standard Deviation 29880.0206
5th Percentile 448340.30
95th Percentile 545798.66
( 95th Percentile - 5th Percentile ) 97458.36
Mean Distribution
Standard Deviation 298.8151
95.00% Confidence Intervall ( 493792.39 - 494963.72 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 140
0.1% Error 14032
0.1 Scale Factor Error with Delta=300 7621587
0.05 Scale Factor Error with Delta=300 30486350
0.01 Scale Factor Error with Delta=300 762158771
Priority Target DPS
Sample Data Bowflexn Priority Target Damage Per Second
Count 9999
Mean 347528.15
Minimum 297785.03
Maximum 412382.79
Spread ( max - min ) 114597.76
Range [ ( max - min ) / 2 * 100% ] 16.49%
Standard Deviation 15191.2652
5th Percentile 323395.98
95th Percentile 373362.52
( 95th Percentile - 5th Percentile ) 49966.53
Mean Distribution
Standard Deviation 151.9202
95.00% Confidence Intervall ( 347230.39 - 347825.91 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 73
0.1% Error 7340
0.1 Scale Factor Error with Delta=300 1970024
0.05 Scale Factor Error with Delta=300 7880096
0.01 Scale Factor Error with Delta=300 197002418
DPS(e)
Sample Data Bowflexn Damage Per Second (Effective)
Count 9999
Mean 494378.05
Minimum 411753.96
Maximum 611158.11
Spread ( max - min ) 199404.14
Range [ ( max - min ) / 2 * 100% ] 20.17%
Damage
Sample Data Bowflexn Damage
Count 9999
Mean 185956958.50
Minimum 147922080.90
Maximum 225509253.45
Spread ( max - min ) 77587172.55
Range [ ( max - min ) / 2 * 100% ] 20.86%
DTPS
Sample Data Bowflexn Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Bowflexn Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Bowflexn Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Bowflexn Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Bowflexn Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Bowflexn Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data BowflexnTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Bowflexn Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=seventh_demon
1 0.00 augmentation,type=defiled
2 0.00 food,name=nightborne_delicacy_platter
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
5 0.00 lightning_shield
Default action list Executed every time the actor is available.
# count action,conditions
6 14.40 wind_shear
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 33.01 auto_attack
8 3.77 feral_spirit
9 1.07 crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.feral_spirit
A 1.00 potion,name=old_war,if=feral_spirit.remains>5|target.time_to_die<=30
0.00 berserking,if=buff.ascendance.up|!talent.ascendance.enabled|level<100
0.00 blood_fury
B 38.98 crash_lightning,if=talent.crashing_storm.enabled&active_enemies>=3
C 4.94 boulderfist,if=buff.boulderfist.remains<gcd&maelstrom>=50&active_enemies>=3
D 32.24 boulderfist,if=buff.boulderfist.remains<gcd|(charges_fractional>1.75&maelstrom<=100&active_enemies<=2)
0.00 crash_lightning,if=buff.crash_lightning.remains<gcd&active_enemies>=2
0.00 windstrike,if=active_enemies>=3&!talent.hailstorm.enabled
0.00 stormstrike,if=active_enemies>=3&!talent.hailstorm.enabled
0.00 windstrike,if=buff.stormbringer.react
E 76.24 stormstrike,if=buff.stormbringer.react
F 10.98 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<gcd
G 5.90 flametongue,if=buff.flametongue.remains<gcd
0.00 windsong
0.00 ascendance
0.00 fury_of_air,if=!ticking
H 6.86 doom_winds
0.00 crash_lightning,if=active_enemies>=3
0.00 windstrike
I 36.26 stormstrike
0.00 lightning_bolt,if=talent.overcharge.enabled&maelstrom>=60
0.00 lava_lash,if=buff.hot_hand.react
0.00 earthen_spike
J 24.93 crash_lightning,if=active_enemies>1|talent.crashing_storm.enabled|feral_spirit.remains>5
K 13.55 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8
L 4.92 flametongue,if=buff.flametongue.remains<4.8
0.00 sundering
M 16.81 lava_lash,if=maelstrom>=90
0.00 rockbiter
N 19.55 flametongue
O 40.37 boulderfist

Sample Sequence

012478D6FGDHIJMDMJMMD7JKIDJLMDOO7BEEEN7BEEIBCFNBEEE6DEID7EEJDFNO7BEEOBO7EEBEEHNOBEEDEED67EFNOO7BIOBEEK7BEEDBIGDJEEDK7ENOO67BEEIB8ACEK7BEEHIEDGIJMMDJK7EEBEEDBEE6GBIK7DBEDIILD6JOOK7BEEIBEDEBEEGBK67DEHOEINJIDOK7B7EE6IBDEEBEEGBCK7EDEE6IDJLO7EBEK7EBE8DBEEEB6EEDG7EEFEHIJCN6O7BEEK7BECEBEIEBDEEG7DEE6FOO7BEEEBG67CIBEEEBDEEDEF7GDHIJOMMJNDK6JO7IOJNOMJEEEIDF7JNOOEEEIJI8DF7EEIDG6JMMMDJEDF7EHIDJGMMDJ

Sample Sequence Table

time name target resources buffs
Pre flask Bowflexn 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre augmentation Bowflexn 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre food Bowflexn 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_the_old_war
0:00.000 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom potion_of_the_old_war
0:01.193 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom bloodlust, stormlash, potion_of_the_old_war
0:02.156 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom bloodlust, boulderfist, landslide, stormlash, potion_of_the_old_war
0:02.156 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom bloodlust, boulderfist, landslide, stormlash, potion_of_the_old_war
0:03.118 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom bloodlust, frostbrand, boulderfist, landslide, stormlash, potion_of_the_old_war
0:04.082 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, stormlash, potion_of_the_old_war
0:05.044 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, stormlash, potion_of_the_old_war
0:05.044 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, stormlash, potion_of_the_old_war
0:06.007 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, stormlash, potion_of_the_old_war
0:06.969 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, potion_of_the_old_war
0:07.932 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, potion_of_the_old_war
0:08.895 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, potion_of_the_old_war
0:09.858 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, potion_of_the_old_war
0:10.821 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, potion_of_the_old_war
0:11.784 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, potion_of_the_old_war
0:12.749 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom bloodlust, raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, potion_of_the_old_war
0:13.711 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms, potion_of_the_old_war
0:13.711 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms, potion_of_the_old_war
0:14.675 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms, potion_of_the_old_war
0:15.611 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms, wail_of_svala, potion_of_the_old_war
0:16.475 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, wail_of_svala, potion_of_the_old_war
0:17.341 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, wail_of_svala, potion_of_the_old_war
0:18.205 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms, wail_of_svala, potion_of_the_old_war
0:19.071 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms, wail_of_svala, potion_of_the_old_war
0:19.935 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala, potion_of_the_old_war
0:20.799 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom bloodlust, raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala, potion_of_the_old_war
0:21.665 Waiting 1.600 sec 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala, potion_of_the_old_war
0:23.265 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala
0:24.438 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
0:24.438 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
0:25.401 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
0:26.365 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
0:27.329 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
0:28.295 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom bloodlust, raid_movement, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
0:29.260 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
0:29.260 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
0:30.223 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash
0:31.186 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom bloodlust, flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
0:32.148 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, wind_strikes, stormlash
0:33.112 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
0:34.077 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, unleash_doom, gathering_storms
0:35.041 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom bloodlust, flametongue, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms
0:36.004 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms
0:36.966 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms
0:37.929 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms
0:38.894 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes
0:39.856 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes
0:40.820 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes
0:40.820 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes
0:42.016 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes
0:43.268 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, wind_strikes
0:44.519 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes
0:45.771 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes
0:45.771 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes
0:46.940 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, howl_of_ingvar, blood_frenzy
0:48.110 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, boulderfist, landslide, howl_of_ingvar, dirge_of_angerboda, blood_frenzy
0:49.278 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, howl_of_ingvar, dirge_of_angerboda, blood_frenzy
0:50.447 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, howl_of_ingvar, dirge_of_angerboda, blood_frenzy
0:51.617 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms, howl_of_ingvar, dirge_of_angerboda, blood_frenzy
0:52.788 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms, howl_of_ingvar, dirge_of_angerboda, blood_frenzy
0:53.957 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms, dirge_of_angerboda, blood_frenzy
0:53.957 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms, dirge_of_angerboda, blood_frenzy
0:55.128 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
0:56.334 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash
0:57.586 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, wind_strikes, stormlash
0:58.837 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash
1:00.089 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
1:01.340 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
1:01.340 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
1:02.592 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide
1:03.810 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
1:04.978 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
1:06.148 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
1:07.318 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, crash_lightning, boulderfist, landslide, blood_frenzy
1:07.318 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, crash_lightning, boulderfist, landslide, doom_winds, blood_frenzy
1:08.487 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, crash_lightning, boulderfist, landslide, doom_winds, blood_frenzy
1:09.656 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, crash_lightning, boulderfist, landslide, doom_winds, blood_frenzy
1:10.826 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, doom_winds, wind_strikes, gathering_storms, stormlash, blood_frenzy
1:11.997 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, doom_winds, wind_strikes, stormlash, blood_frenzy
1:13.167 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, stormbringer, crash_lightning, boulderfist, landslide, doom_winds, wind_strikes, stormlash, blood_frenzy
1:14.407 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, stormbringer, crash_lightning, boulderfist, landslide, stormlash
1:15.659 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
1:16.909 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom raid_movement, flametongue, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
1:18.160 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom
1:18.160 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom
1:18.160 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom
1:19.411 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, crash_lightning, boulderfist, landslide, unleash_doom
1:20.663 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom
1:21.913 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide
1:23.166 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide
1:24.418 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, boulderfist, landslide
1:24.418 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, boulderfist, landslide
1:25.587 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
1:26.757 Waiting 0.700 sec 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
1:27.457 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
1:28.837 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
1:30.251 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
1:31.419 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
1:32.589 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
1:33.759 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
1:33.759 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
1:34.964 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms
1:36.217 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
1:37.470 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash
1:38.722 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash
1:39.892 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash, blood_frenzy
1:41.064 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, dirge_of_angerboda, blood_frenzy
1:42.233 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash, dirge_of_angerboda, blood_frenzy
1:43.402 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash, dirge_of_angerboda, blood_frenzy
1:44.571 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, dirge_of_angerboda, blood_frenzy
1:45.742 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash, dirge_of_angerboda, blood_frenzy
1:46.912 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, dirge_of_angerboda, blood_frenzy
1:48.081 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
1:49.251 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash
1:49.251 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash
1:50.501 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom
1:51.753 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom
1:53.004 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom
1:54.254 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom
1:54.254 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom
1:54.254 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom
1:55.505 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
1:56.758 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, stormlash
1:58.011 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash
1:59.263 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash
2:00.515 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash
2:01.768 potion Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash
2:01.768 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, potion_of_the_old_war
2:03.020 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, potion_of_the_old_war
2:04.272 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, potion_of_the_old_war
2:05.525 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, potion_of_the_old_war
2:05.525 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, potion_of_the_old_war
2:06.776 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, potion_of_the_old_war
2:07.897 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, stormlash, wail_of_svala, potion_of_the_old_war
2:09.019 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash, wail_of_svala, potion_of_the_old_war
2:09.019 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, doom_winds, wind_strikes, stormlash, wail_of_svala, potion_of_the_old_war
2:10.075 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, doom_winds, wind_strikes, stormlash, wail_of_svala, blood_frenzy, potion_of_the_old_war
2:11.129 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, wind_strikes, stormlash, wail_of_svala, blood_frenzy, potion_of_the_old_war
2:12.184 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom frostbrand, crash_lightning, boulderfist, landslide, doom_winds, stormlash, wail_of_svala, blood_frenzy, potion_of_the_old_war
2:13.239 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, stormlash, wail_of_svala, blood_frenzy, potion_of_the_old_war
2:14.294 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, stormlash, wail_of_svala, blood_frenzy, potion_of_the_old_war
2:15.409 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy, potion_of_the_old_war
2:16.580 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy, potion_of_the_old_war
2:17.751 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy, potion_of_the_old_war
2:18.921 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy, potion_of_the_old_war
2:20.166 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash, potion_of_the_old_war
2:21.417 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, potion_of_the_old_war
2:21.417 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, potion_of_the_old_war
2:22.668 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, potion_of_the_old_war
2:23.920 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, potion_of_the_old_war
2:25.171 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, gathering_storms, potion_of_the_old_war
2:26.422 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, potion_of_the_old_war
2:27.674 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes
2:28.927 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes
2:30.178 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
2:31.429 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom frostbrand, stormbringer, crash_lightning, boulderfist, landslide, stormlash
2:32.680 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash
2:32.680 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash
2:33.926 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, wail_of_svala
2:35.050 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, wail_of_svala
2:36.173 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom raid_movement, flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, wail_of_svala
2:37.295 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, wail_of_svala
2:37.295 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, wail_of_svala
2:38.416 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, wail_of_svala
2:39.539 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash, wail_of_svala
2:40.663 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, wail_of_svala
2:41.749 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash, wail_of_svala, blood_frenzy
2:42.906 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
2:44.077 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy
2:45.246 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
2:46.413 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
2:46.413 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
2:47.582 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash, blood_frenzy
2:48.752 Waiting 1.600 sec 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
2:50.352 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
2:51.814 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
2:53.065 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:53.065 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:54.231 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
2:55.400 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
2:56.570 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
2:57.740 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
2:58.909 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
3:00.078 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
3:01.247 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, blood_frenzy
3:02.415 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
3:03.620 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms
3:04.870 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes
3:06.121 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
3:07.373 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
3:08.623 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms
3:09.876 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms
3:09.876 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms
3:09.876 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms
3:11.127 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, gathering_storms
3:12.296 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, blood_frenzy
3:12.296 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, doom_winds, blood_frenzy
3:13.466 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, doom_winds, blood_frenzy
3:14.634 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, unleash_doom, blood_frenzy
3:15.805 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, unleash_doom, blood_frenzy
3:16.975 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, unleash_doom, blood_frenzy
3:18.143 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, unleash_doom, wind_strikes, gathering_storms, blood_frenzy
3:19.315 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy
3:20.483 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, wind_strikes, blood_frenzy
3:21.689 Waiting 1.000 sec 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide
3:22.689 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide
3:23.939 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide
3:23.939 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide
3:25.191 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
3:25.191 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
3:26.443 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
3:27.694 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash
3:27.694 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash
3:28.946 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
3:30.197 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash
3:31.449 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
3:32.681 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy
3:33.850 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
3:35.020 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
3:36.189 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
3:37.359 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
3:38.530 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
3:39.699 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
3:40.869 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
3:42.040 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
3:42.040 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
3:43.266 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide
3:44.517 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes
3:45.766 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
3:46.936 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy
3:46.936 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy
3:48.106 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, dirge_of_angerboda, blood_frenzy
3:49.276 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, dirge_of_angerboda, blood_frenzy
3:50.444 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, howl_of_ingvar, dirge_of_angerboda, blood_frenzy
3:51.612 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, howl_of_ingvar, dirge_of_angerboda, blood_frenzy
3:52.780 Waiting 0.800 sec 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, gathering_storms, howl_of_ingvar, dirge_of_angerboda, blood_frenzy
3:53.580 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms, howl_of_ingvar, dirge_of_angerboda, blood_frenzy
3:53.580 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms, howl_of_ingvar, dirge_of_angerboda, blood_frenzy
3:54.636 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash, howl_of_ingvar, wail_of_svala, dirge_of_angerboda, blood_frenzy
3:55.690 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, howl_of_ingvar, wail_of_svala, blood_frenzy
3:56.745 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom raid_movement, flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, stormlash, howl_of_ingvar, wail_of_svala, blood_frenzy
3:57.801 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, stormlash, wail_of_svala, blood_frenzy
3:57.801 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, stormlash, wail_of_svala, blood_frenzy
3:58.855 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, wail_of_svala, blood_frenzy
3:59.910 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, wail_of_svala, blood_frenzy
4:00.966 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, wail_of_svala, blood_frenzy
4:02.065 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, unleash_doom, blood_frenzy
4:03.235 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy
4:04.404 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
4:05.574 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
4:06.744 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
4:07.916 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
4:09.086 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, blood_frenzy
4:09.086 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, blood_frenzy
4:10.255 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
4:11.424 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
4:12.594 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom raid_movement, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
4:13.764 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, blood_frenzy
4:13.764 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, blood_frenzy
4:14.934 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, blood_frenzy
4:16.102 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
4:17.270 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
4:18.476 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, boulderfist, landslide, wind_strikes, stormlash
4:18.476 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, wind_strikes, stormlash
4:19.727 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, stormlash
4:20.978 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash
4:22.229 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash
4:23.481 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash
4:23.481 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash
4:24.732 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
4:24.732 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
4:25.983 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms
4:27.235 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes
4:28.486 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide
4:29.737 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
4:29.737 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
4:30.987 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms
4:32.238 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes
4:33.490 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, stormlash
4:34.743 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash
4:35.994 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
4:37.247 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
4:38.499 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
4:39.752 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
4:41.002 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash
4:42.252 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash
4:43.503 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom frostbrand, stormbringer, crash_lightning, boulderfist, landslide
4:44.673 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom raid_movement, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
4:45.844 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
4:45.844 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
4:47.013 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, stormlash, blood_frenzy
4:48.184 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, stormbringer, crash_lightning, boulderfist, landslide, stormlash, blood_frenzy
4:49.354 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, crash_lightning, boulderfist, landslide, stormlash, blood_frenzy
4:49.354 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, crash_lightning, boulderfist, landslide, stormlash, blood_frenzy
4:50.524 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash, blood_frenzy
4:51.696 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash, blood_frenzy
4:52.865 Waiting 0.800 sec 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash, blood_frenzy
4:53.665 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash
4:53.665 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash
4:54.916 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
4:56.166 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
4:57.418 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
4:58.667 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash
4:59.919 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
5:01.170 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
5:01.354 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
5:01.354 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
5:02.604 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
5:03.855 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, howl_of_ingvar
5:05.106 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, howl_of_ingvar
5:06.357 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, howl_of_ingvar
5:07.610 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, howl_of_ingvar
5:08.862 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, howl_of_ingvar
5:10.114 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, stormbringer, crash_lightning, boulderfist, landslide, gathering_storms, howl_of_ingvar
5:11.365 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, stormbringer, crash_lightning, boulderfist, landslide, gathering_storms
5:12.616 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes
5:13.866 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes
5:15.117 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, stormbringer, crash_lightning, boulderfist, landslide
5:16.368 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom raid_movement, flametongue, crash_lightning, boulderfist, landslide
5:17.620 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom frostbrand, crash_lightning, boulderfist, landslide
5:17.620 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom frostbrand, crash_lightning, boulderfist, landslide
5:18.872 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide
5:20.101 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, boulderfist, landslide, blood_frenzy
5:20.101 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, blood_frenzy
5:21.270 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, blood_frenzy
5:22.440 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, blood_frenzy
5:23.609 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, blood_frenzy
5:24.778 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, blood_frenzy
5:25.947 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, blood_frenzy
5:27.119 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
5:28.287 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
5:29.456 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
5:30.683 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
5:30.683 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
5:31.936 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
5:33.189 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
5:33.189 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
5:34.439 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom
5:35.690 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom
5:36.941 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms
5:38.148 Waiting 0.600 sec 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms, blood_frenzy
5:38.748 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms, blood_frenzy
5:40.122 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
5:41.292 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
5:42.461 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
5:43.629 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, blood_frenzy
5:44.798 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, blood_frenzy
5:45.968 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, blood_frenzy
5:47.138 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, boulderfist, landslide, blood_frenzy
5:48.363 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide
5:49.615 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, boulderfist, landslide
5:49.615 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, boulderfist, landslide
5:50.784 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
5:51.952 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, howl_of_ingvar, blood_frenzy
5:53.122 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, howl_of_ingvar, blood_frenzy
5:54.492 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, howl_of_ingvar, dirge_of_angerboda, blood_frenzy
5:55.662 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, howl_of_ingvar, dirge_of_angerboda, blood_frenzy
5:56.831 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, howl_of_ingvar, dirge_of_angerboda, blood_frenzy
5:58.000 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, wind_strikes, howl_of_ingvar, dirge_of_angerboda, blood_frenzy
5:59.170 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, howl_of_ingvar, dirge_of_angerboda, blood_frenzy
6:00.388 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, dirge_of_angerboda
6:01.639 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, dirge_of_angerboda
6:02.891 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash
6:04.141 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, stormlash
6:05.392 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, stormlash
6:05.392 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, stormlash
6:06.644 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash, dirge_of_angerboda
6:07.896 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, dirge_of_angerboda
6:09.146 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, dirge_of_angerboda
6:10.397 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, dirge_of_angerboda
6:11.649 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, dirge_of_angerboda
6:11.649 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, dirge_of_angerboda
6:12.900 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, dirge_of_angerboda
6:14.070 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
6:15.239 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
6:16.409 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
6:17.578 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
6:18.746 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
6:19.919 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, blood_frenzy
6:21.090 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom raid_movement, flametongue, stormbringer, boulderfist, landslide, blood_frenzy
6:22.260 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, blood_frenzy
6:22.260 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, blood_frenzy
6:23.466 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide
6:23.466 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds
6:24.714 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds
6:25.964 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds
6:27.216 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms
6:28.468 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms
6:29.720 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
6:30.971 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
6:32.222 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 27136 25430 15192 (12075)
Stamina 36763 36763 21928
Intellect 7651 7326 0
Spirit 0 0 0
Health 2205780 2205780 0
Mana 220000 220000 0
Maelstrom 150 150 0
Spell Power 32563 30516 0
Crit 26.08% 26.08% 3877
Haste 20.22% 20.22% 6570
Damage / Heal Versatility 2.74% 2.74% 1097
Attack Power 27136 25430 0
Mastery 53.42% 51.28% 6173
Armor 2623 2623 2623
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 865.00
Local Head Cave Skulker's Helm
ilevel: 870, stats: { 358 Armor, +2345 Sta, +1563 AgiInt, +1005 Haste, +401 Crit }
Local Neck Amulet of the Last Guardian
ilevel: 865, stats: { +1258 Sta, +1387 Haste, +555 Vers }, gems: { +150 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Burning Sky Pauldrons
ilevel: 850, stats: { 310 Armor, +973 AgiInt, +1459 Sta, +678 Haste, +301 Mastery }, gems: { +150 Mastery }
Local Shirt Orange Martial Shirt
ilevel: 1
Local Chest Mardum Chain Vest
ilevel: 865, stats: { 434 Armor, +1491 AgiInt, +2237 Sta, +838 Crit, +542 Vers }
Local Waist Storm Tempests
ilevel: 895, stats: { 268 Armor, +2219 Sta, +1479 AgiInt, +662 Crit, +496 Haste }
Local Legs Mute Erasure Legguards
ilevel: 860, stats: { 373 Armor, +1424 AgiInt, +2136 Sta, +794 Mastery, +561 Haste }, gems: { +200 Agi }
Local Feet Gravenscale Treads of the Feverflare
ilevel: 855, stats: { 289 Armor, +1529 Sta, +1019 AgiInt, +712 Haste, +285 Mastery }
Local Wrists Vilescale Bracers
ilevel: 860, stats: { 187 Armor, +801 AgiInt, +1201 Sta, +462 Crit, +299 Haste }
Local Hands Gauntlets of Confinement
ilevel: 860, stats: { 267 Armor, +1068 AgiInt, +1601 Sta, +638 Mastery, +377 Crit }
Local Finger1 Ring of Collapsing Futures
ilevel: 865, stats: { +1258 Sta, +1331 Mastery, +610 Haste, +333 Avoidance }, enchant: { +200 Mastery }
Local Finger2 Arch-Druid's Tainted Seal
ilevel: 860, stats: { +1201 Sta, +1362 Mastery, +545 Haste }, enchant: { +200 Mastery }
Local Trinket1 Memento of Angerboda
ilevel: 865, stats: { +1418 StrAgi }
Local Trinket2 Bloodthirsty Instinct
ilevel: 850, stats: { +1233 Agi }, gems: { +150 Mastery }
Local Back Cloak of Fading Echoes
ilevel: 865, stats: { 137 Armor, +839 StrAgiInt, +1258 Sta, +277 Haste, +499 Crit }, enchant: { +200 Agi }
Local Main Hand Doomhammer
ilevel: 881, weapon: { 4398 - 8169, 2.6 }, stats: { +742 Agi, +1113 Sta, +319 Crit, +306 Mastery }, relics: { +43 ilevels, +43 ilevels, +45 ilevels }
Local Off Hand Fury of the Stonemother
ilevel: 881, weapon: { 4398 - 8169, 2.6 }, stats: { +742 Agi, +1113 Sta, +319 Crit, +306 Mastery }
Local Tabard Nightfallen Tabard
ilevel: 800

Talents

Level
15 Windsong (Enhancement Shaman) Hot Hand (Enhancement Shaman) Boulderfist (Enhancement Shaman)
30 Rainfall (Enhancement Shaman) Feral Lunge (Enhancement Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Lightning Shield (Enhancement Shaman) Ancestral Swiftness Hailstorm (Enhancement Shaman)
75 Tempest (Enhancement Shaman) Overcharge (Enhancement Shaman) Empowered Stormlash (Enhancement Shaman)
90 Crashing Storm (Enhancement Shaman) Fury of Air (Enhancement Shaman) Sundering (Enhancement Shaman)
100 Ascendance (Enhancement Shaman) Landslide (Enhancement Shaman) Earthen Spike (Enhancement Shaman)

Profile

shaman="Bowflexn"
origin="https://us.api.battle.net/wow/character/thrall/Bowflexn/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/69/158226501-avatar.jpg"
level=110
race=tauren
role=attack
position=back
professions=leatherworking=800/enchanting=131
talents=3313112
artifact=41:0:0:0:0:899:1:900:1:901:1:902:1:903:1:904:1:905:3:907:3:908:3:909:3:910:3:911:3:912:3:1351:1
spec=enhancement

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=seventh_demon
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/food,name=nightborne_delicacy_platter
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war
actions.precombat+=/lightning_shield

# Executed every time the actor is available.
actions=wind_shear
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions+=/bloodlust,if=target.health.pct<25|time>0.500
actions+=/auto_attack
actions+=/feral_spirit
actions+=/crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.feral_spirit
actions+=/potion,name=old_war,if=feral_spirit.remains>5|target.time_to_die<=30
actions+=/berserking,if=buff.ascendance.up|!talent.ascendance.enabled|level<100
actions+=/blood_fury
actions+=/crash_lightning,if=talent.crashing_storm.enabled&active_enemies>=3
actions+=/boulderfist,if=buff.boulderfist.remains<gcd&maelstrom>=50&active_enemies>=3
actions+=/boulderfist,if=buff.boulderfist.remains<gcd|(charges_fractional>1.75&maelstrom<=100&active_enemies<=2)
actions+=/crash_lightning,if=buff.crash_lightning.remains<gcd&active_enemies>=2
actions+=/windstrike,if=active_enemies>=3&!talent.hailstorm.enabled
actions+=/stormstrike,if=active_enemies>=3&!talent.hailstorm.enabled
actions+=/windstrike,if=buff.stormbringer.react
actions+=/stormstrike,if=buff.stormbringer.react
actions+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<gcd
actions+=/flametongue,if=buff.flametongue.remains<gcd
actions+=/windsong
actions+=/ascendance
actions+=/fury_of_air,if=!ticking
actions+=/doom_winds
actions+=/crash_lightning,if=active_enemies>=3
actions+=/windstrike
actions+=/stormstrike
actions+=/lightning_bolt,if=talent.overcharge.enabled&maelstrom>=60
actions+=/lava_lash,if=buff.hot_hand.react
actions+=/earthen_spike
actions+=/crash_lightning,if=active_enemies>1|talent.crashing_storm.enabled|feral_spirit.remains>5
actions+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8
actions+=/flametongue,if=buff.flametongue.remains<4.8
actions+=/sundering
actions+=/lava_lash,if=maelstrom>=90
actions+=/rockbiter
actions+=/flametongue
actions+=/boulderfist

head=cave_skulkers_helm,id=141455,bonus_id=1482/3336
neck=amulet_of_the_last_guardian,id=142207,bonus_id=1808/3453/1477/3336,gems=150mastery,enchant=mark_of_the_hidden_satyr
shoulders=burning_sky_pauldrons,id=137321,bonus_id=3410/1808/1502/3336,gems=150mastery
back=cloak_of_fading_echoes,id=134405,bonus_id=3412/1517/3337,enchant=200agi
chest=mardum_chain_vest,id=134390,bonus_id=3414/1527/3336
shirt=orange_martial_shirt,id=10052
tabard=nightfallen_tabard,id=140575
wrists=vilescale_bracers,id=121316,bonus_id=3412/1522/3336
hands=gauntlets_of_confinement,id=142133,bonus_id=3453/1472
waist=storm_tempests,id=137103,bonus_id=3459/3458
legs=mute_erasure_legguards,id=134475,bonus_id=3412/1808/1512/3336,gems=200agi
feet=gravenscale_treads,id=128901,bonus_id=689/1697/3408/600/670
finger1=ring_of_collapsing_futures,id=142173,bonus_id=40/3453/1477/3336,enchant=200mastery
finger2=archdruids_tainted_seal,id=134487,bonus_id=3412/1512/3336,enchant=200mastery
trinket1=memento_of_angerboda,id=133644,bonus_id=3414/1517/3336
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1808/1472,gems=150mastery
main_hand=doomhammer,id=128819,bonus_id=745,gem_id=136769/141268/137365/0,relic_id=1727:1502:3336/3432:1512:3337/3410:1507:3336/0
off_hand=fury_of_the_stonemother,id=128873

# Gear Summary
# gear_ilvl=865.44
# gear_agility=15192
# gear_stamina=21928
# gear_crit_rating=3877
# gear_haste_rating=6570
# gear_mastery_rating=6173
# gear_versatility_rating=1097
# gear_avoidance_rating=333
# gear_armor=2623

Alacastria

Alacastria : 274640 dps, 124324 dps to main target, 13328 dtps, 50514 hps (50514 aps), 59.6k TMI, 63.5k ETMI

  • Race: Blood Elf
  • Class: Warrior
  • Spec: Protection
  • Level: 110
  • Role: Tank
  • Position: front

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR APS APS Error APS Range APR
274640.4 274640.4 374.7 / 0.136% 68403.5 / 24.9% 57797.5 50514.5 81.49 / 0.16% 8045 / 15.9% 0.0
DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max MSD Freq.   Window Bin Size
13327.8 28.60 / 0.21% 5761 / 43.2%       59.6k 18 / 0.03% 57.4k 64.8k 3.5k / 5.8%       17.5% 6.6% 33.8% 30.4       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
4.7 4.7 Rage 4.28% 57.6 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Alacastria/advanced
Talents
  • 15: Shockwave (Protection Warrior)
  • 30: Inspiring Presence (Protection Warrior)
  • 45: Renewed Fury (Protection Warrior)
  • 60: Crackling Thunder (Protection Warrior)
  • 75: Indomitable (Protection Warrior)
  • 90: Booming Voice (Protection Warrior)
  • 100: Heavy Repercussions (Protection Warrior)
  • Talent Calculator
Artifact
Professions
  • mining: 784
  • blacksmithing: 758
Scale Factors for Alacastria Damage Taken Per Second
Haste Mastery Crit Vers Str
Scale Factors -0.27 -0.14 -0.14 -0.14 -0.08
Normalized 3.33 1.75 1.72 1.71 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.04 0.04 0.04 0.04 0.04
Gear Ranking
Optimizers
Ranking
  • Haste > Mastery ~= Crit ~= Vers > Str
Pawn string ( Pawn: v1: "Alacastria": Strength=0.08, CritRating=0.14, HasteRating=0.27, MasteryRating=0.14, Versatility=0.14 )

Scale Factors for other metrics

Scale Factors for Alacastria Damage Per Second
Str Vers Mastery Crit Haste
Scale Factors 10.85 5.82 5.03 4.89 3.29
Normalized 1.00 0.54 0.46 0.45 0.30
Scale Deltas 1138 1138 1138 1138 1138
Error 0.48 0.47 0.47 0.47 0.47
Gear Ranking
Optimizers
Ranking
  • Str > Vers > Mastery ~= Crit > Haste
Pawn string ( Pawn: v1: "Alacastria": Strength=10.85, CritRating=4.89, HasteRating=3.29, MasteryRating=5.03, Versatility=5.82 )
Scale Factors for Alacastria Priority Target Damage Per Second
Str Vers Crit Mastery Haste
Scale Factors 4.83 2.64 2.42 2.26 1.94
Normalized 1.00 0.55 0.50 0.47 0.40
Scale Deltas 1138 1138 1138 1138 1138
Error 0.06 0.06 0.06 0.06 0.06
Gear Ranking
Optimizers
Ranking
  • Str > Vers > Crit > Mastery > Haste
Pawn string ( Pawn: v1: "Alacastria": Strength=4.83, CritRating=2.42, HasteRating=1.94, MasteryRating=2.26, Versatility=2.64 )
Scale Factors for Alacastria Damage Per Second (Effective)
Str Vers Mastery Crit Haste
Scale Factors 10.85 5.82 5.03 4.89 3.29
Normalized 1.00 0.54 0.46 0.45 0.30
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Str > Vers > Mastery > Crit > Haste
Pawn string ( Pawn: v1: "Alacastria": Strength=10.85, CritRating=4.89, HasteRating=3.29, MasteryRating=5.03, Versatility=5.82 )
Scale Factors for Alacastria Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Alacastria": )
Scale Factors for Alacastria Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Alacastria": )
Scale Factors for Alacastria Absorb Per Second
Vers Mastery Crit Str Haste
Scale Factors -0.82 -0.65 -0.34 -0.29 -0.20
Normalized 2.86 2.29 1.20 1.00 0.72
Scale Deltas 1138 1138 1138 1138 1138
Error 0.10 0.10 0.10 0.10 0.10
Gear Ranking
Optimizers
Ranking
  • Vers > Mastery > Crit ~= Str ~= Haste
Pawn string ( Pawn: v1: "Alacastria": Strength=0.29, CritRating=0.34, HasteRating=0.20, MasteryRating=0.65, Versatility=0.82 )
Scale Factors for Healing + Absorb per second
Vers Mastery Crit Str Haste
Scale Factors -0.82 -0.65 -0.34 -0.29 -0.20
Normalized 2.86 2.29 1.20 1.00 0.72
Scale Deltas 1138 1138 1138 1138 1138
Error 0.10 0.10 0.10 0.10 0.10
Gear Ranking
Optimizers
Ranking
  • Vers > Mastery > Crit ~= Str ~= Haste
Pawn string ( Pawn: v1: "Alacastria": Strength=0.29, CritRating=0.34, HasteRating=0.20, MasteryRating=0.65, Versatility=0.82 )
Scale Factors for Alacastria Damage Taken Per Second
Haste Mastery Crit Vers Str
Scale Factors -0.27 -0.14 -0.14 -0.14 -0.08
Normalized 3.33 1.75 1.72 1.71 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.04 0.04 0.04 0.04 0.04
Gear Ranking
Optimizers
Ranking
  • Haste > Mastery ~= Crit ~= Vers > Str
Pawn string ( Pawn: v1: "Alacastria": Strength=0.08, CritRating=0.14, HasteRating=0.27, MasteryRating=0.14, Versatility=0.14 )
Scale Factors for Alacastria Damage Taken
Haste Crit Mastery Vers Str
Scale Factors -109.79 -57.58 -57.19 -55.62 -33.30
Normalized 3.30 1.73 1.72 1.67 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Haste > Crit > Mastery > Vers > Str
Pawn string ( Pawn: v1: "Alacastria": Strength=33.30, CritRating=57.58, HasteRating=109.79, MasteryRating=57.19, Versatility=55.62 )
Scale Factors for Alacastria Healing Taken Per Second
Mastery Haste Vers Crit Str
Scale Factors 0.17 0.10 0.07 0.06 0.03
Normalized 5.57 3.21 2.26 1.86 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Mastery > Haste > Vers > Crit > Str
Pawn string ( Pawn: v1: "Alacastria": Strength=0.03, CritRating=0.06, HasteRating=0.10, MasteryRating=0.17, Versatility=0.07 )
Scale Factors for Alacastria Theck-Meloree Index
Haste Crit Mastery Str Vers
Scale Factors -0.15 -0.06 -0.06 -0.04 -0.02
Normalized 4.40 1.72 1.57 1.00 0.67
Scale Deltas 1138 1138 1138 1138 1138
Error 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Optimizers
Ranking
  • Haste > Crit ~= Mastery ~= Str ~= Vers
Pawn string ( Pawn: v1: "Alacastria": Strength=0.04, CritRating=0.06, HasteRating=0.15, MasteryRating=0.06, Versatility=0.02 )
Scale Factors for AlacastriaTheck-Meloree Index (Effective)
Haste Mastery Vers Crit Str
Scale Factors -0.14 -0.09 -0.07 -0.07 -0.04
Normalized 3.40 2.15 1.76 1.65 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Optimizers
Ranking
  • Haste > Mastery ~= Vers ~= Crit > Str
Pawn string ( Pawn: v1: "Alacastria": Strength=0.04, CritRating=0.07, HasteRating=0.14, MasteryRating=0.09, Versatility=0.07 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% B% Up%
Alacastria 274640
auto_attack_mh 12887 4.7% 164.5 2.45sec 31382 14600 Direct 164.5 25488 54449 31382 20.4% 7.5%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 164.47 164.47 0.00 0.00 2.1494 0.0000 5161285.17 7761668.69 33.50 14599.90 14599.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.19 73.69% 26073.51 25054 33071 26072.44 25713 26439 3159807 4645216 31.98
hit (blocked) 9.81 5.96% 18253.41 17538 23150 18252.31 0 21220 179051 376031 52.38
crit 30.97 18.83% 55696.19 50107 66142 55754.28 53078 58758 1725161 2536150 31.98
crit (blocked) 2.50 1.52% 38973.16 35075 46299 35843.50 0 46299 97266 204271 48.16
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Deep Wounds 52121 18.9% 317.3 2.19sec 65184 0 Periodic 370.1 43495 93026 55890 25.0% 0.0% 277.1%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 317.30 0.00 370.06 370.06 0.0000 3.0000 20682677.87 20682677.87 0.00 18629.87 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 277.5 74.98% 43494.90 41808 55187 43494.94 42812 44359 12068016 12068016 0.00
crit 92.6 25.02% 93025.87 83616 110373 93050.79 89007 97508 8614662 8614662 0.00
 
 

Action details: deep_wounds

Static Values
  • id:115767
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec.
  • description:{$@spelldesc115768=Your Devastate and Revenge also cause $115767o1 Bleed damage over {$115767d=15 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.050000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Devastate 32639 12.0% 140.3 2.86sec 93629 66407 Direct 140.3 77478 164623 93630 18.5% 7.5%  

Stats details: devastate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.25 140.25 0.00 0.00 1.4099 0.0000 13131561.11 19749108.85 33.51 66406.88 66406.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 105.66 75.34% 79266.66 75152 99200 79265.20 77643 80715 8375148 12312261 31.98
hit (blocked) 8.60 6.13% 55492.67 52606 69440 55468.71 0 65582 477119 1002014 52.37
crit 24.06 17.16% 168364.21 150303 198400 168573.54 158520 183370 4050950 5955280 31.98
crit (blocked) 1.93 1.38% 118068.08 105212 138880 101013.45 0 138880 228344 479553 44.82
 
 

Action details: devastate

Static Values
  • id:20243
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20243
  • name:Devastate
  • school:physical
  • tooltip:
  • description:A direct strike, dealing ${$sw1*$<mult>} Physical damage.$?a231834[ {$s3=30}% chance to reset the remaining cooldown on Shield Slam.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.20
 
Gaseous Explosion (gaseous_bubble) 27974 10.1% 7.0 60.03sec 1577452 0 Direct 31.9 201073 411129 346945 69.4% 0.0%  

Stats details: gaseous_bubble

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.02 31.93 0.00 0.00 0.0000 0.0000 11077031.80 11077031.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.75 30.55% 201073.36 179363 236759 201411.64 0 236759 1961238 1961238 0.00
crit 22.17 69.45% 411129.22 358725 473517 410451.62 358725 473517 9115793 9115793 0.00
 
 

Action details: gaseous_bubble

Static Values
  • id:214972
  • school:frost
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:214972
  • name:Gaseous Explosion
  • school:frost
  • tooltip:
  • description:{$@spelldesc214971=Become enveloped by a Gaseous Bubble that absorbs up to {$s1=212375} damage for {$d=8 seconds}. When the bubble is consumed or expires, it explodes and deals {$s2=94857} Frost damage to all nearby enemies within $214972A1 yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:137680.00
  • base_dd_max:137680.00
 
Neltharion's Fury 37581 13.6% 5.0 60.66sec 2964712 1970766 Periodic 180.0 38655 82436 82429 100.0% 0.0% 3.7%

Stats details: neltharions_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.01 0.00 30.03 180.03 1.5045 0.5000 14839865.92 14839865.92 0.00 658174.74 1970765.73
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.0 0.02% 38654.94 35836 39419 212.74 0 39419 1106 1106 0.00
crit 180.0 99.98% 82435.68 71671 94606 82435.99 78695 85146 14838760 14838760 0.00
 
 

Action details: neltharions_fury

Static Values
  • id:203524
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:incoming_damage_2500ms>health.max*0.20&!buff.shield_block.up
Spelldata
  • id:203524
  • name:Neltharion's Fury
  • school:physical
  • tooltip:Critically blocking all incoming attacks, and dealing {$203526s1=1} Shadowflame damage to all enemies in a $203526A1 yard cone every $t2 sec.
  • description:Enter a defensive posture, critically blocking all attacks while a stream of shadowflame erupts from |cFFFFCC99Scale of the Earth-Warder|r, dealing ${6*{$203526s1=1}} Shadowflame over {$d=3 seconds} to all enemies in front of you. You can use defensive abilities while this is active.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: neltharions_fury_shadowflame

Static Values
  • id:203526
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203526
  • name:Neltharion's Fury
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc203524=Enter a defensive posture, critically blocking all attacks while a stream of shadowflame erupts from |cFFFFCC99Scale of the Earth-Warder|r, dealing ${6*{$203526s1=1}} Shadowflame over {$d=3 seconds} to all enemies in front of you. You can use defensive abilities while this is active.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.900000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Revenge 54054 19.6% 42.5 9.23sec 503139 355574 Direct 177.0 95789 202933 120875 23.4% 5.3%  

Stats details: revenge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.53 177.05 0.00 0.00 1.4150 0.0000 21400592.29 31629501.64 32.34 355574.26 355574.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 128.45 72.55% 96325.78 92141 121625 96315.43 93506 100327 12372927 18189375 31.98
hit (blocked) 7.15 4.04% 86146.63 64498 121625 86061.34 0 121625 615712 1011914 39.12
crit 39.28 22.19% 203936.91 184281 243251 203761.85 185159 224696 8011307 11777381 31.98
crit (blocked) 2.17 1.22% 184744.45 128997 243251 163069.13 0 243251 400645 650831 33.90
 
 

Action details: revenge

Static Values
  • id:6572
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.shield_slam.remains<=gcd.max*2
Spelldata
  • id:6572
  • name:Revenge
  • school:physical
  • tooltip:
  • description:Swing in a wide arc, dealing {$s1=1} damage to all enemies in front of you. Your successful dodges and parries reset the remaining cooldown on Revenge up to once per $5302m1 sec. |cFFFFFFFFGenerates {$/10;s2=5} Rage.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.402000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shield Slam 32642 12.0% 56.4 7.21sec 232108 164488 Direct 56.4 169702 362033 232105 32.4% 7.5%  

Stats details: shield_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.42 56.42 0.00 0.00 1.4111 0.0000 13095738.42 19693205.80 33.50 164488.33 164488.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.26 62.49% 173604.87 133471 229036 173528.74 161742 183656 6121232 8998791 31.98
hit (blocked) 2.85 5.06% 121479.56 93429 160325 114463.21 0 160325 346687 728089 49.38
crit 16.94 30.03% 370306.35 266941 458071 370681.58 325020 415561 6274186 9223648 31.98
crit (blocked) 1.36 2.42% 259261.42 186859 320650 191603.46 0 320650 353633 742677 38.69
 
 

Action details: shield_slam

Static Values
  • id:23922
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
Spelldata
  • id:23922
  • name:Shield Slam
  • school:physical
  • tooltip:
  • description:Slams the target with your shield, causing {$s1=1} Physical damage. |cFFFFFFFFGenerates {$/10;s3=20} Rage.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:4.928000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Thunder Clap 24743 9.0% 27.1 10.89sec 360057 256299 Direct 162.8 46925 99454 60009 24.9% 0.0%  

Stats details: thunder_clap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.14 162.82 0.00 0.00 1.4048 0.0000 9770646.29 14363775.55 31.98 256299.41 256299.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 122.26 75.09% 46924.81 44798 59133 46922.50 45472 48692 5737091 8434067 31.98
crit 40.56 24.91% 99453.61 89596 118266 99407.69 90386 107281 4033556 5929709 31.98
 
 

Action details: thunder_clap

Static Values
  • id:6343
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.thunder_clap>=3
Spelldata
  • id:6343
  • name:Thunder Clap
  • school:physical
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Blasts all enemies within $6343A1 yards for $?s12712[${$6343m1*1.2}][$6343m1] damage{$?s199045=false}[, rooting them for {$199042d=1 second} and reducing their movement speed by {$s2=50}% for {$d=10 seconds}.][ and reduces their movement speed by {$s2=50}% for {$d=10 seconds}.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.654000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Healing and Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
Alacastria 0
Ignore Pain 50497 100.0% 26.7 15.49sec 758872 0 Direct 237.2 85342 0 85342 0.0%  

Stats details: ignore_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 26.68 237.21 0.00 0.00 0.0000 0.0000 20243639.43 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 237.21 100.00% 85341.75 0 208369 85331.80 77427 93889 20243639 0 0.00
 
 

Action details: ignore_pain

Static Values
  • id:190456
  • school:physical
  • resource:rage
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:40.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:(rage>=60&!talent.vengeance.enabled)|(buff.vengeance_ignore_pain.up&buff.ultimatum.up)|(buff.vengeance_ignore_pain.up&rage>=39)|(talent.vengeance.enabled&!buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage<30)
Spelldata
  • id:190456
  • name:Ignore Pain
  • school:physical
  • tooltip:Ignoring {$s2=90}% of the next ${$w1*10/9} total damage that you take, from any sources.
  • description:Fight through the pain, ignoring {$s2=90}% of the next up to ${($m1/10)*$AP*(1+$@versadmg)} damage you take from any sources, based on Rage spent.
 
Simple Action Stats Execute Interval
Alacastria
Arcane Torrent 4.9 90.30sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.93 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:69179
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:69179
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and increase your Rage by {$/10;s2=15}. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:false
  • if_expr:
 
Battle Cry 7.1 60.70sec

Stats details: battle_cry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.07 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: battle_cry

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
Spelldata
  • id:1719
  • name:Battle Cry
  • school:physical
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
 
Demoralizing Shout 3.7 121.35sec

Stats details: demoralizing_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: demoralizing_shout

Static Values
  • id:1160
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:incoming_damage_2500ms>health.max*0.20
Spelldata
  • id:1160
  • name:Demoralizing Shout
  • school:physical
  • tooltip:{$?s199023=false}[Demoralized, dealing {$s1=20}% less damage.][Demoralized, dealing {$s1=20}% less damage to the shouting Warrior.]
  • description:{$?s199023=false}[Demoralizes all enemies within $A2 yards, reducing the damage they do by {$s1=20}% for {$d=8 seconds}.][Demoralizes all enemies within $A2 yards, reducing the damage they do to you by {$s1=20}% for {$d=8 seconds}.]{$?s202743=false}[ |cFFFFFFFFGenerates ${$m5/10} Rage.|r][]
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:false
  • if_expr:
 
Intercept 20.1 20.42sec

Stats details: intercept

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.11 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: intercept

Static Values
  • id:198304
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198304
  • name:Intercept
  • school:physical
  • tooltip:
  • description:Run at high speed toward an ally or enemy. When targeting an enemy, Intercept will root for {$105771d=1.500 seconds}, but has a minimum range of {$s1=8} yds. When targeting an ally, Intercept will intercept the next melee or ranged attack against the ally within {$147833d=10 seconds} while the target remains within $147833A2 yards. |cFFFFFFFFGenerates {$/10;s2=10} Rage.|r
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shield Block 28.8 14.28sec

Stats details: shield_block

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shield_block

Static Values
  • id:2565
  • school:physical
  • resource:rage
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:0.0
  • cooldown:13.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.neltharions_fury.up&((cooldown.shield_slam.remains<6&!buff.shield_block.up)|(cooldown.shield_slam.remains<6+buff.shield_block.remains&buff.shield_block.up))
Spelldata
  • id:2565
  • name:Shield Block
  • school:physical
  • tooltip:
  • description:Raise your shield, blocking every melee attack against you for {$132404d=6 seconds}. These blocks can be critical blocks. Increases Shield Slam damage by {$132404s2=30}% while active.
 
Shield Block (_heavy_repercussions) 49.1 8.32sec

Stats details: shield_block_heavy_repercussions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.10 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shield_block_heavy_repercussions

Static Values
  • id:2565
  • school:physical
  • resource:rage
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2565
  • name:Shield Block
  • school:physical
  • tooltip:
  • description:Raise your shield, blocking every melee attack against you for {$132404d=6 seconds}. These blocks can be critical blocks. Increases Shield Slam damage by {$132404s2=30}% while active.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Battle Cry 7.1 0.0 60.9sec 60.7sec 8.79% 8.79% 0.0(0.0) 7.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_battle_cry
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • battle_cry_1:8.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Battle Cry
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 26.58% 0.0(0.0) 1.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demoralizing Shout 3.7 0.0 121.8sec 121.4sec 7.40% 7.40% 0.0(0.0) 3.7

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_demoralizing_shout
  • max_stacks:1
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • demoralizing_shout_1:7.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1160
  • name:Demoralizing Shout
  • tooltip:{$?s199023=false}[Demoralized, dealing {$s1=20}% less damage.][Demoralized, dealing {$s1=20}% less damage to the shouting Warrior.]
  • description:{$?s199023=false}[Demoralizes all enemies within $A2 yards, reducing the damage they do by {$s1=20}% for {$d=8 seconds}.][Demoralizes all enemies within $A2 yards, reducing the damage they do to you by {$s1=20}% for {$d=8 seconds}.]{$?s202743=false}[ |cFFFFFFFFGenerates ${$m5/10} Rage.|r][]
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
Dragon Scales 13.8 0.0 28.9sec 28.9sec 24.20% 24.20% 0.0(0.0) 3.1

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_dragon_scales
  • max_stacks:1
  • duration:12.00
  • cooldown:15.00
  • default_chance:20.00%
  • default_value:0.40

Stack Uptimes

  • dragon_scales_1:24.20%

Trigger Attempt Success

  • trigger_pct:20.55%

Spelldata details

  • id:203581
  • name:Dragon Scales
  • tooltip:Your next Ignore Pain will ignore {$s1=40}% more damage.
  • description:{$@spelldesc203576=Blocking an attack has a chance to increase the total damage ignored by your next Ignore Pain by {$203581s1=40}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Gaseous Bubble 7.1 0.0 60.4sec 60.5sec 9.03% 100.00% 0.0(0.0) 1.1

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_gaseous_bubble
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:308250.00

Stack Uptimes

  • gaseous_bubble_1:9.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214971
  • name:Gaseous Bubble
  • tooltip:Absorbs $w1 damage. Causes a Gaseous Explosion when removed.
  • description:Become enveloped by a Gaseous Bubble that absorbs up to {$s1=212375} damage for {$d=8 seconds}. When the bubble is consumed or expires, it explodes and deals {$s2=94857} Frost damage to all nearby enemies within $214972A1 yards.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignore Pain 15.6 11.1 26.3sec 15.5sec 86.42% 100.00% 11.1(11.1) 14.7

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_ignore_pain
  • max_stacks:1
  • duration:15.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:186.00

Stack Uptimes

  • ignore_pain_1:86.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190456
  • name:Ignore Pain
  • tooltip:Ignoring {$s2=90}% of the next ${$w1*10/9} total damage that you take, from any sources.
  • description:Fight through the pain, ignoring {$s2=90}% of the next up to ${($m1/10)*$AP*(1+$@versadmg)} damage you take from any sources, based on Rage spent.
  • max_stacks:0
  • duration:15.00
  • cooldown:1.00
  • default_chance:0.00%
intercept_movement 3.0 0.0 88.6sec 88.6sec 0.24% 1.67% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_intercept_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • intercept_movement_1:0.24%

Trigger Attempt Success

  • trigger_pct:100.00%
Mark of the Heavy Hide 9.0 2.4 43.0sec 33.3sec 25.04% 25.04% 2.4(2.4) 8.7

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_mark_of_the_heavy_hide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:bonus_armor
  • amount:3000.00

Stack Uptimes

  • mark_of_the_heavy_hide_1:25.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:228399
  • name:Mark of the Heavy Hide
  • tooltip:Armor increased by {$s1=3000}.
  • description:Armor increased by {$s1=3000}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Neltharion's Fury 5.0 0.0 60.6sec 60.6sec 3.80% 3.80% 30.0(30.0) 5.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_neltharions_fury
  • max_stacks:1
  • duration:3.00
  • cooldown:45.00
  • default_chance:100.00%
  • default_value:3.00

Stack Uptimes

  • neltharions_fury_1:3.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203524
  • name:Neltharion's Fury
  • tooltip:Critically blocking all incoming attacks, and dealing {$203526s1=1} Shadowflame damage to all enemies in a $203526A1 yard cone every $t2 sec.
  • description:Enter a defensive posture, critically blocking all attacks while a stream of shadowflame erupts from |cFFFFCC99Scale of the Earth-Warder|r, dealing ${6*{$203526s1=1}} Shadowflame over {$d=3 seconds} to all enemies in front of you. You can use defensive abilities while this is active.
  • max_stacks:0
  • duration:3.00
  • cooldown:45.00
  • default_chance:0.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 13.33% 13.33% 2.0(2.0) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%
Renewed Fury 25.0 1.7 16.3sec 15.5sec 38.77% 38.77% 1.7(1.7) 24.6

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_renewed_fury
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • renewed_fury_1:38.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202289
  • name:Renewed Fury
  • tooltip:Damage done increased by {$s1=10}%.
  • description:{$@spelldesc202288=Ignore Pain also enrages you, increasing all damage you deal by {$202289s1=10}% for {$202289d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Shield Block 28.1 0.0 14.5sec 14.5sec 60.95% 86.93% 0.0(0.0) 27.4

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_shield_block
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shield_block_1:60.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:132404
  • name:Shield Block
  • tooltip:Block chance increased by {$s1=100}%.
  • description:{$@spelldesc2565=Raise your shield, blocking every melee attack against you for {$132404d=6 seconds}. These blocks can be critical blocks. Increases Shield Slam damage by {$132404s2=30}% while active.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Unbending Potion 2.0 0.0 321.2sec 0.0sec 11.83% 11.83% 0.0(0.0) 1.5

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_unbending_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:bonus_armor
  • amount:3500.00

Stack Uptimes

  • unbending_potion_1:11.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188029
  • name:Unbending Potion
  • tooltip:Armor increased by {$s1=3500}.
  • description:Increases your Armor by {$s1=3500} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Intercept0.4870.0011.2558.0484.87411.142
Shield Block2.0370.00322.36954.79722.515118.495
Ignore Pain14.2830.45132.301366.743270.077459.184
Demoralizing Shout31.8290.00133.69086.87332.002128.600
Battle Cry1.0190.0012.6565.5181.89110.101
Neltharion's Fury15.64314.99697.91062.65961.294159.375
Shield Slam1.6970.00122.07793.26749.411150.107
Revenge2.1170.00142.51687.59027.933172.045
Thunder Clap5.2680.00726.465137.690110.694172.495

Resources

Resource Usage Type Count Total Average RPE APR
Alacastria
ignore_pain Rage 26.7 1600.6 60.0 60.0 12647.8
shield_block Rage 28.8 288.1 10.0 10.0 0.0
Resource Gains Type Count Total Average Overflow
ignore_pain Health 237.20 20243391.64 (100.00%) 85341.75 0.00 0.00%
intercept Rage 20.11 201.14 (10.47%) 10.00 0.00 0.00%
arcane_torrent Rage 4.93 73.92 (3.85%) 15.00 0.00 0.00%
shield_slam Rage 56.42 1128.41 (58.72%) 20.00 0.00 0.00%
revenge Rage 42.53 212.67 (11.07%) 5.00 0.00 0.00%
booming_voice Rage 3.73 186.50 (9.71%) 50.00 0.00 0.00%
rage_from_damage_taken Rage 274.82 119.01 (6.19%) 0.43 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 8301.63 13324.22
Rage 4.80 4.71
Combat End Resource Mean Min Max
Rage 33.25 0.01 80.19

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
parry_haste 19.6 19.4sec
delayed_auto_attack 13.1 27.6sec

Statistics & Data Analysis

Fight Length
Sample Data Alacastria Fight Length
Count 9999
Mean 400.62
Minimum 307.54
Maximum 499.01
Spread ( max - min ) 191.47
Range [ ( max - min ) / 2 * 100% ] 23.90%
DPS
Sample Data Alacastria Damage Per Second
Count 9999
Mean 274640.43
Minimum 232515.15
Maximum 334612.38
Spread ( max - min ) 102097.23
Range [ ( max - min ) / 2 * 100% ] 18.59%
Standard Deviation 19117.2478
5th Percentile 246912.54
95th Percentile 308338.32
( 95th Percentile - 5th Percentile ) 61425.78
Mean Distribution
Standard Deviation 191.1820
95.00% Confidence Intervall ( 274265.72 - 275015.14 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 186
0.1% Error 18613
0.1 Scale Factor Error with Delta=300 3119854
0.05 Scale Factor Error with Delta=300 12479419
0.01 Scale Factor Error with Delta=300 311985499
Priority Target DPS
Sample Data Alacastria Priority Target Damage Per Second
Count 9999
Mean 124323.78
Minimum 115832.86
Maximum 133986.64
Spread ( max - min ) 18153.78
Range [ ( max - min ) / 2 * 100% ] 7.30%
Standard Deviation 2443.7721
5th Percentile 120369.37
95th Percentile 128422.33
( 95th Percentile - 5th Percentile ) 8052.96
Mean Distribution
Standard Deviation 24.4389
95.00% Confidence Intervall ( 124275.89 - 124371.68 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1484
0.1 Scale Factor Error with Delta=300 50980
0.05 Scale Factor Error with Delta=300 203922
0.01 Scale Factor Error with Delta=300 5098061
DPS(e)
Sample Data Alacastria Damage Per Second (Effective)
Count 9999
Mean 274640.43
Minimum 232515.15
Maximum 334612.38
Spread ( max - min ) 102097.23
Range [ ( max - min ) / 2 * 100% ] 18.59%
Damage
Sample Data Alacastria Damage
Count 9999
Mean 109159398.89
Minimum 92086714.63
Maximum 124787030.15
Spread ( max - min ) 32700315.52
Range [ ( max - min ) / 2 * 100% ] 14.98%
DTPS
Sample Data Alacastria Damage Taken Per Second
Count 9999
Mean 13327.85
Minimum 8182.29
Maximum 18282.82
Spread ( max - min ) 10100.52
Range [ ( max - min ) / 2 * 100% ] 37.89%
Standard Deviation 1459.3592
5th Percentile 10971.86
95th Percentile 15814.92
( 95th Percentile - 5th Percentile ) 4843.06
Mean Distribution
Standard Deviation 14.5943
95.00% Confidence Intervall ( 13299.24 - 13356.45 )
Normalized 95.00% Confidence Intervall ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 460
0.1% Error 46057
0.1 Scale Factor Error with Delta=300 18180
0.05 Scale Factor Error with Delta=300 72722
0.01 Scale Factor Error with Delta=300 1818059
HPS
Sample Data Alacastria Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Alacastria Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Alacastria Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Alacastria Healing Taken Per Second
Count 9999
Mean 8277.71
Minimum 4323.91
Maximum 11457.76
Spread ( max - min ) 7133.85
Range [ ( max - min ) / 2 * 100% ] 43.09%
TMI
Sample Data Alacastria Theck-Meloree Index
Count 9999
Mean 59646.16
Minimum 57365.25
Maximum 64753.63
Spread ( max - min ) 7388.38
Range [ ( max - min ) / 2 * 100% ] 6.19%
Standard Deviation 900.4772
5th Percentile 58300.03
95th Percentile 61246.77
( 95th Percentile - 5th Percentile ) 2946.74
Mean Distribution
Standard Deviation 9.0052
95.00% Confidence Intervall ( 59628.51 - 59663.81 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 875
0.1 Scale Factor Error with Delta=300 6921
0.05 Scale Factor Error with Delta=300 27687
0.01 Scale Factor Error with Delta=300 692196
ETMI
Sample Data AlacastriaTheck-Meloree Index (Effective)
Count 9999
Mean 63509.11
Minimum 61432.34
Maximum 66571.46
Spread ( max - min ) 5139.12
Range [ ( max - min ) / 2 * 100% ] 4.05%
Standard Deviation 691.7828
5th Percentile 62447.66
95th Percentile 64716.78
( 95th Percentile - 5th Percentile ) 2269.12
Mean Distribution
Standard Deviation 6.9182
95.00% Confidence Intervall ( 63495.55 - 63522.67 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 4
0.1% Error 455
0.1 Scale Factor Error with Delta=300 4085
0.05 Scale Factor Error with Delta=300 16341
0.01 Scale Factor Error with Delta=300 408529
MSD
Sample Data Alacastria Max Spike Value
Count 2503
Mean 17.48
Minimum 6.56
Maximum 33.85
Spread ( max - min ) 27.29
Range [ ( max - min ) / 2 * 100% ] 78.08%
Standard Deviation 3.9644
5th Percentile 11.66
95th Percentile 24.70
( 95th Percentile - 5th Percentile ) 13.04
Mean Distribution
Standard Deviation 0.0792
95.00% Confidence Intervall ( 17.32 - 17.63 )
Normalized 95.00% Confidence Intervall ( 99.11% - 100.89% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 1976
0.1% Error 197689
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 13

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=countless_armies
1 0.00 food,type=seedbattered_fish_plate
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=unbending_potion
Default action list Executed every time the actor is available.
# count action,conditions
5 20.11 intercept
6 14.11 auto_attack
7 7.11 use_item,name=giant_ornamental_pearl
0.00 blood_fury
0.00 berserking
8 4.93 arcane_torrent
9 0.00 call_action_list,name=prot
actions.prot
# count action,conditions
A 28.81 shield_block,if=!buff.neltharions_fury.up&((cooldown.shield_slam.remains<6&!buff.shield_block.up)|(cooldown.shield_slam.remains<6+buff.shield_block.remains&buff.shield_block.up))
B 26.68 ignore_pain,if=(rage>=60&!talent.vengeance.enabled)|(buff.vengeance_ignore_pain.up&buff.ultimatum.up)|(buff.vengeance_ignore_pain.up&rage>=39)|(talent.vengeance.enabled&!buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage<30)
0.00 focused_rage,if=(buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(buff.ultimatum.up&buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(talent.vengeance.enabled&buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up)|(talent.vengeance.enabled&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage>=30)|(buff.ultimatum.up&buff.vengeance_ignore_pain.up&cooldown.shield_slam.remains=0&rage<10)|(rage>=100)
C 0.00 demoralizing_shout,if=incoming_damage_2500ms>health.max*0.20
0.00 shield_wall,if=incoming_damage_2500ms>health.max*0.50
0.00 last_stand,if=incoming_damage_2500ms>health.max*0.50&!cooldown.shield_wall.remains=0
D 1.00 potion,name=unbending_potion,if=(incoming_damage_2500ms>health.max*0.15&!buff.potion.up)|target.time_to_die<=25
E 0.00 call_action_list,name=prot_aoe,if=spell_targets.neltharions_fury>=2
0.00 focused_rage,if=talent.ultimatum.enabled&buff.ultimatum.up&!talent.vengeance.enabled
F 2.07 battle_cry,if=(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
G 1.73 demoralizing_shout,if=talent.booming_voice.enabled&buff.battle_cry.up
0.00 ravager,if=talent.ravager.enabled&buff.battle_cry.up
H 0.01 neltharions_fury,if=incoming_damage_2500ms>health.max*0.20&!buff.shield_block.up
I 32.81 shield_slam,if=!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
J 15.63 revenge,if=cooldown.shield_slam.remains<=gcd.max*2
K 93.63 devastate
actions.prot_aoe
# count action,conditions
0.00 focused_rage,if=talent.ultimatum.enabled&buff.ultimatum.up&!talent.vengeance.enabled
L 5.00 battle_cry,if=(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
M 2.00 demoralizing_shout,if=talent.booming_voice.enabled&buff.battle_cry.up
0.00 ravager,if=talent.ravager.enabled&buff.battle_cry.up
N 5.00 neltharions_fury,if=buff.battle_cry.up
O 23.61 shield_slam,if=!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
P 26.90 revenge
Q 27.14 thunder_clap,if=spell_targets.thunder_clap>=3
R 46.62 devastate

Sample Sequence

01245678AFGBIKKKJKIKKAIBK6KKJKIKK56APQPORQR6RPAOBQROROBPQR5AIKKKJKI6RAQPRO7BP5LNQRRAOPKKKKIBKJ56RAOQRPR8BQORRAPQRI5KIBKJKAI6RQPRO7PQ5ALMBNPROBQKIKJAIKKPQ5BROPQARORQPROBQKK5AIKKKJ6RQRAORO78BPP5LNQRRAOBKKKIKK6P5AOPQRRRBOPQARRKIK5IBKKK6PAOQROR7PQLMBN5RRAOBKKKJKIK6PAO5QRBRR8POQRARRJIKK5BIKK6PAQORRO7BPQLN5RAOQKKJKIBKKKJAKI5KKIK6IBKKAKJKIKKK5JKAIBKKKIKKK78JAIKFGBK5KIBKDKKJAIKKKIKKJ5BKAIK

Sample Sequence Table

time name target resources buffs
Pre flask Alacastria 0.0/130: 0% rage
Pre food Alacastria 0.0/130: 0% rage
Pre augmentation Alacastria 0.0/130: 0% rage
Pre potion Fluffy_Pillow 0.0/130: 0% rage unbending_potion
0:00.000 intercept Fluffy_Pillow 0.0/130: 0% rage unbending_potion
0:00.000 auto_attack Fluffy_Pillow 10.0/130: 8% rage unbending_potion
0:00.000 use_item_giant_ornamental_pearl Fluffy_Pillow 10.0/130: 8% rage unbending_potion
0:00.000 arcane_torrent Fluffy_Pillow 10.0/130: 8% rage gaseous_bubble, unbending_potion
0:00.000 shield_block Fluffy_Pillow 25.0/130: 19% rage gaseous_bubble, unbending_potion
0:00.000 battle_cry Fluffy_Pillow 15.0/130: 12% rage shield_block, gaseous_bubble, unbending_potion
0:00.000 demoralizing_shout Fluffy_Pillow 15.0/130: 12% rage battle_cry, shield_block, gaseous_bubble, unbending_potion
0:00.000 ignore_pain Alacastria 65.0/130: 50% rage demoralizing_shout, battle_cry, shield_block, gaseous_bubble, unbending_potion
0:00.000 shield_slam Fluffy_Pillow 5.0/130: 4% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, unbending_potion
0:01.349 devastate Fluffy_Pillow 25.0/130: 19% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, unbending_potion
0:02.468 devastate Fluffy_Pillow 25.0/130: 19% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, unbending_potion
0:03.588 devastate Fluffy_Pillow 25.0/130: 19% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, unbending_potion
0:04.708 revenge Fluffy_Pillow 25.0/130: 19% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, unbending_potion
0:05.828 devastate Fluffy_Pillow 30.0/130: 23% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, shield_block, gaseous_bubble, unbending_potion
0:06.946 shield_slam Fluffy_Pillow 30.0/130: 23% rage bloodlust, demoralizing_shout, ignore_pain, shield_block, gaseous_bubble, unbending_potion
0:08.065 devastate Fluffy_Pillow 50.2/130: 39% rage bloodlust, dragon_scales, ignore_pain, shield_block, unbending_potion
0:09.182 devastate Fluffy_Pillow 50.3/130: 39% rage bloodlust, dragon_scales, ignore_pain, unbending_potion
0:10.301 shield_block Fluffy_Pillow 50.3/130: 39% rage bloodlust, dragon_scales, ignore_pain, unbending_potion
0:10.301 shield_slam Fluffy_Pillow 40.3/130: 31% rage bloodlust, dragon_scales, ignore_pain, shield_block, unbending_potion
0:11.419 ignore_pain Alacastria 60.4/130: 46% rage bloodlust, dragon_scales, ignore_pain, shield_block, unbending_potion
0:11.419 devastate Fluffy_Pillow 0.4/130: 0% rage bloodlust, renewed_fury, ignore_pain, shield_block, unbending_potion
0:12.538 auto_attack Fluffy_Pillow 0.6/130: 0% rage bloodlust, raid_movement, renewed_fury, ignore_pain, shield_block, unbending_potion
0:12.538 devastate Fluffy_Pillow 0.6/130: 0% rage bloodlust, raid_movement, renewed_fury, ignore_pain, shield_block, unbending_potion
0:13.657 devastate Fluffy_Pillow 0.8/130: 1% rage bloodlust, renewed_fury, ignore_pain, shield_block, unbending_potion
0:14.777 revenge Fluffy_Pillow 1.0/130: 1% rage bloodlust, renewed_fury, ignore_pain, shield_block, unbending_potion
0:15.895 devastate Fluffy_Pillow 6.1/130: 5% rage bloodlust, renewed_fury, ignore_pain, shield_block, unbending_potion
0:17.013 shield_slam Fluffy_Pillow 6.2/130: 5% rage bloodlust, renewed_fury, ignore_pain, shield_block, unbending_potion
0:18.133 devastate Fluffy_Pillow 26.4/130: 20% rage bloodlust, ignore_pain, shield_block, unbending_potion
0:19.253 devastate Fluffy_Pillow 26.5/130: 20% rage bloodlust, ignore_pain, shield_block, unbending_potion
0:20.374 intercept Fluffy_Pillow 26.8/130: 21% rage bloodlust, raid_movement, ignore_pain, unbending_potion
0:20.374 Waiting 0.500 sec 36.8/130: 28% rage bloodlust, raid_movement, intercept_movement, ignore_pain, unbending_potion
0:20.874 auto_attack Fluffy_Pillow 36.8/130: 28% rage bloodlust, intercept_movement, ignore_pain, unbending_potion
0:20.874 shield_block Fluffy_Pillow 36.8/130: 28% rage bloodlust, intercept_movement, ignore_pain, unbending_potion
0:20.874 revenge Fluffy_Pillow 26.8/130: 21% rage bloodlust, intercept_movement, ignore_pain, shield_block, unbending_potion
0:21.993 thunder_clap Fluffy_Pillow 31.9/130: 25% rage bloodlust, ignore_pain, shield_block, unbending_potion
0:23.115 revenge Fluffy_Pillow 32.1/130: 25% rage bloodlust, ignore_pain, shield_block
0:24.236 shield_slam Fluffy_Pillow 37.2/130: 29% rage bloodlust, ignore_pain, shield_block
0:25.355 devastate Fluffy_Pillow 57.2/130: 44% rage bloodlust, ignore_pain, shield_block
0:26.473 thunder_clap Fluffy_Pillow 57.4/130: 44% rage bloodlust, shield_block
0:27.592 devastate Fluffy_Pillow 57.4/130: 44% rage bloodlust, shield_block
0:28.712 auto_attack Fluffy_Pillow 59.9/130: 46% rage bloodlust, raid_movement
0:28.712 devastate Fluffy_Pillow 59.9/130: 46% rage bloodlust, raid_movement
0:29.830 revenge Fluffy_Pillow 59.9/130: 46% rage bloodlust
0:30.951 shield_block Fluffy_Pillow 68.6/130: 53% rage bloodlust
0:30.951 shield_slam Fluffy_Pillow 58.6/130: 45% rage bloodlust, shield_block
0:32.072 ignore_pain Alacastria 80.0/130: 62% rage bloodlust, shield_block
0:32.072 thunder_clap Fluffy_Pillow 20.0/130: 15% rage bloodlust, renewed_fury, ignore_pain, shield_block
0:33.192 devastate Fluffy_Pillow 20.0/130: 15% rage bloodlust, renewed_fury, ignore_pain, shield_block
0:34.311 shield_slam Fluffy_Pillow 20.2/130: 16% rage bloodlust, renewed_fury, dragon_scales, ignore_pain, shield_block
0:35.430 devastate Fluffy_Pillow 40.2/130: 31% rage bloodlust, renewed_fury, dragon_scales, ignore_pain, shield_block
0:36.549 shield_slam Fluffy_Pillow 40.5/130: 31% rage bloodlust, renewed_fury, dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
0:37.667 ignore_pain Alacastria 60.5/130: 47% rage bloodlust, renewed_fury, dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
0:37.667 revenge Fluffy_Pillow 0.5/130: 0% rage bloodlust, renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
0:38.788 thunder_clap Fluffy_Pillow 5.6/130: 4% rage bloodlust, renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
0:39.907 devastate Fluffy_Pillow 5.6/130: 4% rage bloodlust, renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
0:41.035 intercept Fluffy_Pillow 5.6/130: 4% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
0:41.035 shield_block Fluffy_Pillow 15.6/130: 12% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
0:41.035 shield_slam Fluffy_Pillow 5.6/130: 4% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
0:42.490 devastate Fluffy_Pillow 26.0/130: 20% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
0:43.945 devastate Fluffy_Pillow 26.0/130: 20% rage ignore_pain, shield_block, mark_of_the_heavy_hide
0:45.400 devastate Fluffy_Pillow 26.2/130: 20% rage ignore_pain, shield_block, mark_of_the_heavy_hide
0:46.854 revenge Fluffy_Pillow 26.4/130: 20% rage ignore_pain, shield_block
0:48.309 devastate Fluffy_Pillow 31.8/130: 24% rage ignore_pain, shield_block
0:49.764 shield_slam Fluffy_Pillow 31.8/130: 24% rage ignore_pain
0:51.220 Waiting 1.800 sec 52.2/130: 40% rage raid_movement, ignore_pain
0:53.020 auto_attack Fluffy_Pillow 52.7/130: 41% rage raid_movement
0:53.020 devastate Fluffy_Pillow 52.7/130: 41% rage raid_movement
0:54.474 shield_block Fluffy_Pillow 57.8/130: 44% rage
0:54.474 thunder_clap Fluffy_Pillow 47.8/130: 37% rage shield_block
0:55.928 revenge Fluffy_Pillow 47.8/130: 37% rage shield_block, mark_of_the_heavy_hide
0:57.383 devastate Fluffy_Pillow 55.3/130: 43% rage shield_block, mark_of_the_heavy_hide
0:58.837 shield_slam Fluffy_Pillow 57.6/130: 44% rage shield_block, mark_of_the_heavy_hide
1:00.291 use_item_giant_ornamental_pearl Fluffy_Pillow 78.8/130: 61% rage raid_movement, shield_block, mark_of_the_heavy_hide
1:00.291 ignore_pain Alacastria 78.8/130: 61% rage raid_movement, shield_block, gaseous_bubble, mark_of_the_heavy_hide
1:00.291 Waiting 0.300 sec 18.8/130: 14% rage raid_movement, renewed_fury, ignore_pain, shield_block, gaseous_bubble, mark_of_the_heavy_hide
1:00.591 revenge Fluffy_Pillow 18.8/130: 14% rage raid_movement, renewed_fury, ignore_pain, shield_block, gaseous_bubble, mark_of_the_heavy_hide
1:02.048 intercept Fluffy_Pillow 23.8/130: 18% rage renewed_fury, ignore_pain, gaseous_bubble, mark_of_the_heavy_hide
1:02.048 battle_cry Fluffy_Pillow 33.8/130: 26% rage renewed_fury, ignore_pain, gaseous_bubble, mark_of_the_heavy_hide
1:02.048 neltharions_fury Fluffy_Pillow 33.8/130: 26% rage renewed_fury, ignore_pain, battle_cry, gaseous_bubble, mark_of_the_heavy_hide
1:03.554 thunder_clap Fluffy_Pillow 33.8/130: 26% rage renewed_fury, ignore_pain, neltharions_fury, battle_cry, gaseous_bubble, mark_of_the_heavy_hide
1:05.009 devastate Fluffy_Pillow 33.8/130: 26% rage renewed_fury, ignore_pain, neltharions_fury, battle_cry, gaseous_bubble, mark_of_the_heavy_hide
1:06.464 devastate Fluffy_Pillow 34.5/130: 27% rage ignore_pain, battle_cry
1:07.919 shield_block Fluffy_Pillow 34.5/130: 27% rage ignore_pain
1:07.919 shield_slam Fluffy_Pillow 24.5/130: 19% rage ignore_pain, shield_block
1:09.374 revenge Fluffy_Pillow 44.7/130: 34% rage ignore_pain, shield_block
1:10.826 devastate Fluffy_Pillow 49.8/130: 38% rage ignore_pain, shield_block
1:12.282 devastate Fluffy_Pillow 50.1/130: 39% rage dragon_scales, ignore_pain, shield_block
1:13.737 devastate Fluffy_Pillow 50.1/130: 39% rage dragon_scales, ignore_pain, shield_block
1:15.190 devastate Fluffy_Pillow 50.3/130: 39% rage dragon_scales, ignore_pain, shield_block
1:16.645 shield_slam Fluffy_Pillow 50.3/130: 39% rage raid_movement, dragon_scales
1:18.100 ignore_pain Alacastria 74.1/130: 57% rage dragon_scales
1:18.100 devastate Fluffy_Pillow 14.1/130: 11% rage renewed_fury, ignore_pain
1:19.553 revenge Fluffy_Pillow 14.4/130: 11% rage renewed_fury, ignore_pain
1:21.007 Waiting 0.800 sec 19.7/130: 15% rage raid_movement, renewed_fury, ignore_pain
1:21.807 intercept Fluffy_Pillow 19.7/130: 15% rage raid_movement, renewed_fury, ignore_pain
1:22.048 Waiting 0.200 sec 30.1/130: 23% rage raid_movement, renewed_fury, intercept_movement, ignore_pain
1:22.248 auto_attack Fluffy_Pillow 30.1/130: 23% rage raid_movement, renewed_fury, intercept_movement, ignore_pain
1:22.248 devastate Fluffy_Pillow 30.1/130: 23% rage raid_movement, renewed_fury, intercept_movement, ignore_pain
1:23.702 shield_block Fluffy_Pillow 30.1/130: 23% rage renewed_fury, ignore_pain
1:23.702 shield_slam Fluffy_Pillow 20.1/130: 15% rage renewed_fury, ignore_pain, shield_block
1:25.156 thunder_clap Fluffy_Pillow 40.3/130: 31% rage ignore_pain, shield_block
1:26.610 devastate Fluffy_Pillow 40.5/130: 31% rage ignore_pain, shield_block
1:28.064 revenge Fluffy_Pillow 40.6/130: 31% rage ignore_pain, shield_block
1:29.520 devastate Fluffy_Pillow 45.7/130: 35% rage ignore_pain, shield_block
1:30.974 arcane_torrent Fluffy_Pillow 45.8/130: 35% rage ignore_pain, shield_block
1:30.974 ignore_pain Alacastria 60.8/130: 47% rage ignore_pain, shield_block
1:30.974 thunder_clap Fluffy_Pillow 0.8/130: 1% rage renewed_fury, ignore_pain, shield_block
1:32.428 Waiting 0.100 sec 1.3/130: 1% rage raid_movement, renewed_fury, ignore_pain
1:32.528 shield_slam Fluffy_Pillow 1.3/130: 1% rage raid_movement, renewed_fury, ignore_pain
1:33.982 devastate Fluffy_Pillow 21.4/130: 16% rage renewed_fury, ignore_pain
1:35.439 devastate Fluffy_Pillow 22.2/130: 17% rage renewed_fury, ignore_pain
1:36.894 shield_block Fluffy_Pillow 22.2/130: 17% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
1:36.894 revenge Fluffy_Pillow 12.2/130: 9% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
1:38.350 thunder_clap Fluffy_Pillow 17.5/130: 13% rage dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
1:39.802 devastate Fluffy_Pillow 17.7/130: 14% rage dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
1:41.255 shield_slam Fluffy_Pillow 18.0/130: 14% rage dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
1:42.709 intercept Fluffy_Pillow 38.2/130: 29% rage dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
1:42.709 devastate Fluffy_Pillow 48.2/130: 37% rage dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
1:44.165 shield_slam Fluffy_Pillow 48.3/130: 37% rage dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
1:45.620 ignore_pain Alacastria 68.4/130: 53% rage dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
1:45.620 devastate Fluffy_Pillow 8.4/130: 6% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
1:47.075 revenge Fluffy_Pillow 8.7/130: 7% rage renewed_fury, ignore_pain
1:48.529 devastate Fluffy_Pillow 14.1/130: 11% rage raid_movement, renewed_fury, ignore_pain
1:49.982 shield_block Fluffy_Pillow 14.1/130: 11% rage renewed_fury, ignore_pain
1:49.982 shield_slam Fluffy_Pillow 4.1/130: 3% rage renewed_fury, ignore_pain, shield_block
1:51.436 Waiting 1.500 sec 24.3/130: 19% rage raid_movement, renewed_fury, ignore_pain, shield_block
1:52.936 auto_attack Fluffy_Pillow 24.6/130: 19% rage raid_movement, ignore_pain, shield_block
1:52.936 devastate Fluffy_Pillow 24.6/130: 19% rage raid_movement, ignore_pain, shield_block
1:54.391 thunder_clap Fluffy_Pillow 24.8/130: 19% rage ignore_pain, shield_block
1:55.847 revenge Fluffy_Pillow 24.8/130: 19% rage ignore_pain, shield_block
1:57.301 devastate Fluffy_Pillow 30.4/130: 23% rage ignore_pain, shield_block
1:58.754 shield_slam Fluffy_Pillow 30.4/130: 23% rage ignore_pain
2:00.209 use_item_giant_ornamental_pearl Fluffy_Pillow 50.8/130: 39% rage ignore_pain
2:00.291 revenge Fluffy_Pillow 50.8/130: 39% rage ignore_pain, gaseous_bubble
2:01.748 thunder_clap Fluffy_Pillow 55.8/130: 43% rage gaseous_bubble
2:03.202 intercept Fluffy_Pillow 55.8/130: 43% rage gaseous_bubble
2:03.202 shield_block Fluffy_Pillow 65.8/130: 51% rage gaseous_bubble
2:03.202 battle_cry Fluffy_Pillow 55.8/130: 43% rage shield_block, gaseous_bubble
2:03.202 demoralizing_shout Fluffy_Pillow 55.8/130: 43% rage battle_cry, shield_block, gaseous_bubble
2:03.202 ignore_pain Alacastria 105.8/130: 81% rage demoralizing_shout, battle_cry, shield_block, gaseous_bubble
2:03.202 neltharions_fury Fluffy_Pillow 45.8/130: 35% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble
2:04.707 revenge Fluffy_Pillow 45.8/130: 35% rage raid_movement, renewed_fury, demoralizing_shout, dragon_scales, ignore_pain, neltharions_fury, battle_cry, shield_block, gaseous_bubble
2:06.161 devastate Fluffy_Pillow 50.8/130: 39% rage renewed_fury, demoralizing_shout, dragon_scales, ignore_pain, neltharions_fury, battle_cry, shield_block, gaseous_bubble
2:07.616 shield_slam Fluffy_Pillow 50.8/130: 39% rage renewed_fury, demoralizing_shout, dragon_scales, ignore_pain, battle_cry, shield_block, gaseous_bubble
2:09.072 ignore_pain Alacastria 70.9/130: 55% rage renewed_fury, demoralizing_shout, dragon_scales, ignore_pain, shield_block
2:09.072 thunder_clap Fluffy_Pillow 10.9/130: 8% rage renewed_fury, demoralizing_shout, ignore_pain, shield_block
2:10.528 devastate Fluffy_Pillow 11.1/130: 9% rage renewed_fury, demoralizing_shout, ignore_pain, shield_block
2:11.981 shield_slam Fluffy_Pillow 11.1/130: 9% rage renewed_fury, ignore_pain
2:13.435 devastate Fluffy_Pillow 31.6/130: 24% rage renewed_fury, ignore_pain
2:14.891 revenge Fluffy_Pillow 32.1/130: 25% rage renewed_fury, ignore_pain
2:16.347 shield_block Fluffy_Pillow 37.3/130: 29% rage ignore_pain
2:16.347 shield_slam Fluffy_Pillow 27.3/130: 21% rage ignore_pain, shield_block
2:17.803 devastate Fluffy_Pillow 47.3/130: 36% rage ignore_pain, shield_block
2:19.257 devastate Fluffy_Pillow 47.5/130: 37% rage ignore_pain, shield_block
2:20.712 revenge Fluffy_Pillow 47.8/130: 37% rage ignore_pain, shield_block
2:22.167 thunder_clap Fluffy_Pillow 53.2/130: 41% rage ignore_pain, shield_block
2:23.620 intercept Fluffy_Pillow 53.2/130: 41% rage ignore_pain, shield_block, mark_of_the_heavy_hide
2:23.620 ignore_pain Alacastria 63.2/130: 49% rage ignore_pain, shield_block, mark_of_the_heavy_hide
2:23.620 devastate Fluffy_Pillow 3.2/130: 2% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
2:25.074 shield_slam Fluffy_Pillow 3.3/130: 3% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
2:26.530 revenge Fluffy_Pillow 23.7/130: 18% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
2:27.983 thunder_clap Fluffy_Pillow 28.7/130: 22% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
2:29.438 shield_block Fluffy_Pillow 29.0/130: 22% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
2:29.438 devastate Fluffy_Pillow 19.0/130: 15% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
2:30.892 shield_slam Fluffy_Pillow 19.2/130: 15% rage ignore_pain, shield_block, mark_of_the_heavy_hide
2:32.346 devastate Fluffy_Pillow 39.5/130: 30% rage dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
2:33.799 thunder_clap Fluffy_Pillow 39.5/130: 30% rage dragon_scales, ignore_pain, shield_block
2:35.254 revenge Fluffy_Pillow 39.9/130: 31% rage dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
2:36.709 devastate Fluffy_Pillow 45.1/130: 35% rage raid_movement, dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
2:38.163 shield_slam Fluffy_Pillow 45.2/130: 35% rage dragon_scales, ignore_pain, mark_of_the_heavy_hide
2:39.616 ignore_pain Alacastria 65.2/130: 50% rage dragon_scales, mark_of_the_heavy_hide
2:39.616 thunder_clap Fluffy_Pillow 5.2/130: 4% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
2:41.070 devastate Fluffy_Pillow 5.5/130: 4% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
2:42.525 devastate Fluffy_Pillow 5.8/130: 4% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
2:43.980 intercept Fluffy_Pillow 5.8/130: 4% rage renewed_fury, ignore_pain
2:43.980 shield_block Fluffy_Pillow 15.8/130: 12% rage renewed_fury, ignore_pain
2:43.980 shield_slam Fluffy_Pillow 5.8/130: 4% rage renewed_fury, ignore_pain, shield_block
2:45.435 devastate Fluffy_Pillow 26.0/130: 20% rage renewed_fury, ignore_pain, shield_block
2:46.889 devastate Fluffy_Pillow 26.1/130: 20% rage ignore_pain, shield_block
2:48.344 devastate Fluffy_Pillow 26.1/130: 20% rage ignore_pain, shield_block
2:49.798 revenge Fluffy_Pillow 26.2/130: 20% rage ignore_pain, shield_block
2:51.254 Waiting 1.100 sec 31.5/130: 24% rage raid_movement, ignore_pain, shield_block
2:52.354 auto_attack Fluffy_Pillow 31.8/130: 24% rage raid_movement, ignore_pain
2:52.354 devastate Fluffy_Pillow 31.8/130: 24% rage raid_movement, ignore_pain
2:53.807 thunder_clap Fluffy_Pillow 31.9/130: 25% rage ignore_pain
2:55.261 devastate Fluffy_Pillow 33.6/130: 26% rage
2:56.716 shield_block Fluffy_Pillow 36.9/130: 28% rage
2:56.716 shield_slam Fluffy_Pillow 26.9/130: 21% rage shield_block
2:58.171 devastate Fluffy_Pillow 49.4/130: 38% rage shield_block
2:59.626 shield_slam Fluffy_Pillow 50.6/130: 39% rage shield_block
3:01.081 use_item_giant_ornamental_pearl Fluffy_Pillow 76.0/130: 58% rage shield_block
3:01.081 arcane_torrent Fluffy_Pillow 76.0/130: 58% rage shield_block, gaseous_bubble
3:01.081 ignore_pain Alacastria 91.0/130: 70% rage shield_block, gaseous_bubble
3:01.081 revenge Fluffy_Pillow 31.0/130: 24% rage renewed_fury, ignore_pain, shield_block, gaseous_bubble
3:02.536 revenge Fluffy_Pillow 36.0/130: 28% rage renewed_fury, ignore_pain, shield_block, gaseous_bubble
3:03.991 intercept Fluffy_Pillow 41.0/130: 32% rage renewed_fury, ignore_pain, shield_block, gaseous_bubble
3:03.991 battle_cry Fluffy_Pillow 51.0/130: 39% rage renewed_fury, ignore_pain, shield_block, gaseous_bubble
3:03.991 neltharions_fury Fluffy_Pillow 51.0/130: 39% rage renewed_fury, ignore_pain, battle_cry, shield_block, gaseous_bubble
3:05.495 thunder_clap Fluffy_Pillow 51.0/130: 39% rage renewed_fury, dragon_scales, ignore_pain, neltharions_fury, battle_cry, shield_block, gaseous_bubble
3:06.949 devastate Fluffy_Pillow 51.0/130: 39% rage renewed_fury, dragon_scales, ignore_pain, neltharions_fury, battle_cry, gaseous_bubble
3:08.405 Waiting 0.100 sec 51.4/130: 40% rage raid_movement, dragon_scales, ignore_pain, battle_cry
3:08.505 devastate Fluffy_Pillow 51.4/130: 40% rage raid_movement, dragon_scales, ignore_pain, battle_cry
3:09.960 shield_block Fluffy_Pillow 51.4/130: 40% rage dragon_scales, ignore_pain
3:09.960 shield_slam Fluffy_Pillow 41.4/130: 32% rage dragon_scales, ignore_pain, shield_block
3:11.415 ignore_pain Alacastria 61.7/130: 47% rage dragon_scales, ignore_pain, shield_block
3:11.415 devastate Fluffy_Pillow 1.7/130: 1% rage renewed_fury, ignore_pain, shield_block
3:12.869 devastate Fluffy_Pillow 1.7/130: 1% rage renewed_fury, ignore_pain, shield_block
3:14.323 devastate Fluffy_Pillow 1.9/130: 1% rage renewed_fury, ignore_pain, shield_block
3:15.777 shield_slam Fluffy_Pillow 1.9/130: 1% rage renewed_fury, ignore_pain, shield_block
3:17.231 devastate Fluffy_Pillow 22.2/130: 17% rage renewed_fury, ignore_pain, shield_block
3:18.685 devastate Fluffy_Pillow 22.5/130: 17% rage ignore_pain, shield_block
3:20.140 Waiting 2.800 sec 22.8/130: 18% rage raid_movement, ignore_pain
3:22.940 auto_attack Fluffy_Pillow 23.1/130: 18% rage raid_movement, ignore_pain
3:22.940 revenge Fluffy_Pillow 23.1/130: 18% rage raid_movement, ignore_pain
3:24.394 intercept Fluffy_Pillow 28.1/130: 22% rage raid_movement, ignore_pain
3:24.394 Waiting 0.100 sec 38.1/130: 29% rage raid_movement, intercept_movement, ignore_pain
3:24.494 shield_block Fluffy_Pillow 38.1/130: 29% rage intercept_movement, ignore_pain
3:24.494 shield_slam Fluffy_Pillow 28.1/130: 22% rage intercept_movement, ignore_pain, shield_block
3:25.948 revenge Fluffy_Pillow 48.1/130: 37% rage ignore_pain, shield_block
3:27.403 thunder_clap Fluffy_Pillow 53.4/130: 41% rage shield_block
3:28.857 devastate Fluffy_Pillow 54.9/130: 42% rage shield_block
3:30.310 devastate Fluffy_Pillow 59.4/130: 46% rage shield_block
3:31.765 devastate Fluffy_Pillow 59.4/130: 46% rage shield_block
3:33.218 ignore_pain Alacastria 64.2/130: 49% rage
3:33.218 shield_slam Fluffy_Pillow 4.2/130: 3% rage renewed_fury, ignore_pain
3:34.674 revenge Fluffy_Pillow 24.4/130: 19% rage renewed_fury, ignore_pain
3:36.130 thunder_clap Fluffy_Pillow 29.9/130: 23% rage renewed_fury, ignore_pain
3:37.582 shield_block Fluffy_Pillow 29.9/130: 23% rage renewed_fury, ignore_pain
3:37.582 devastate Fluffy_Pillow 19.9/130: 15% rage renewed_fury, ignore_pain, shield_block
3:39.038 devastate Fluffy_Pillow 20.3/130: 16% rage renewed_fury, ignore_pain, shield_block
3:40.493 Waiting 0.100 sec 20.7/130: 16% rage raid_movement, ignore_pain, shield_block
3:40.593 devastate Fluffy_Pillow 20.7/130: 16% rage raid_movement, ignore_pain, shield_block
3:42.049 shield_slam Fluffy_Pillow 20.8/130: 16% rage ignore_pain, shield_block
3:43.503 devastate Fluffy_Pillow 41.0/130: 32% rage ignore_pain, shield_block, mark_of_the_heavy_hide
3:44.958 intercept Fluffy_Pillow 41.3/130: 32% rage ignore_pain, shield_block, mark_of_the_heavy_hide
3:44.958 shield_slam Fluffy_Pillow 51.3/130: 39% rage ignore_pain, shield_block, mark_of_the_heavy_hide
3:46.413 ignore_pain Alacastria 71.4/130: 55% rage ignore_pain, shield_block, mark_of_the_heavy_hide
3:46.413 devastate Fluffy_Pillow 11.4/130: 9% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
3:47.868 devastate Fluffy_Pillow 11.4/130: 9% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
3:49.323 devastate Fluffy_Pillow 12.1/130: 9% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
3:50.778 Waiting 2.200 sec 12.3/130: 9% rage raid_movement, renewed_fury, ignore_pain, mark_of_the_heavy_hide
3:52.978 auto_attack Fluffy_Pillow 12.6/130: 10% rage raid_movement, ignore_pain
3:52.978 revenge Fluffy_Pillow 12.6/130: 10% rage raid_movement, ignore_pain
3:54.433 shield_block Fluffy_Pillow 17.7/130: 14% rage ignore_pain
3:54.433 shield_slam Fluffy_Pillow 7.7/130: 6% rage ignore_pain, shield_block
3:55.886 thunder_clap Fluffy_Pillow 27.7/130: 21% rage ignore_pain, shield_block
3:57.338 devastate Fluffy_Pillow 28.0/130: 22% rage ignore_pain, shield_block
3:58.793 shield_slam Fluffy_Pillow 28.1/130: 22% rage ignore_pain, shield_block
4:00.246 devastate Fluffy_Pillow 48.5/130: 37% rage ignore_pain, shield_block
4:01.698 use_item_giant_ornamental_pearl Fluffy_Pillow 48.5/130: 37% rage shield_block
4:01.698 revenge Fluffy_Pillow 48.5/130: 37% rage shield_block, gaseous_bubble
4:03.152 thunder_clap Fluffy_Pillow 53.5/130: 41% rage shield_block, gaseous_bubble
4:04.606 battle_cry Fluffy_Pillow 53.5/130: 41% rage gaseous_bubble
4:04.606 demoralizing_shout Fluffy_Pillow 53.5/130: 41% rage battle_cry, gaseous_bubble
4:04.606 ignore_pain Alacastria 103.5/130: 80% rage demoralizing_shout, battle_cry, gaseous_bubble
4:04.606 neltharions_fury Fluffy_Pillow 43.5/130: 33% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, gaseous_bubble
4:06.110 intercept Fluffy_Pillow 43.5/130: 33% rage renewed_fury, demoralizing_shout, dragon_scales, ignore_pain, neltharions_fury, battle_cry, gaseous_bubble
4:06.110 devastate Fluffy_Pillow 53.5/130: 41% rage renewed_fury, demoralizing_shout, dragon_scales, ignore_pain, neltharions_fury, battle_cry, gaseous_bubble
4:07.563 devastate Fluffy_Pillow 53.5/130: 41% rage renewed_fury, demoralizing_shout, dragon_scales, ignore_pain, neltharions_fury, battle_cry, gaseous_bubble
4:09.016 shield_block Fluffy_Pillow 53.7/130: 41% rage renewed_fury, demoralizing_shout, dragon_scales, ignore_pain, battle_cry
4:09.016 shield_slam Fluffy_Pillow 43.7/130: 34% rage renewed_fury, demoralizing_shout, dragon_scales, ignore_pain, battle_cry, shield_block
4:10.471 ignore_pain Alacastria 63.8/130: 49% rage renewed_fury, demoralizing_shout, dragon_scales, ignore_pain, shield_block
4:10.471 devastate Fluffy_Pillow 3.8/130: 3% rage renewed_fury, demoralizing_shout, ignore_pain, shield_block
4:11.925 devastate Fluffy_Pillow 3.9/130: 3% rage renewed_fury, demoralizing_shout, ignore_pain, shield_block
4:13.380 devastate Fluffy_Pillow 4.1/130: 3% rage renewed_fury, ignore_pain, shield_block
4:14.834 revenge Fluffy_Pillow 4.4/130: 3% rage renewed_fury, ignore_pain, shield_block
4:16.288 devastate Fluffy_Pillow 9.8/130: 8% rage renewed_fury, ignore_pain, shield_block
4:17.743 shield_slam Fluffy_Pillow 9.9/130: 8% rage ignore_pain
4:19.198 devastate Fluffy_Pillow 30.2/130: 23% rage ignore_pain
4:20.653 Waiting 2.300 sec 30.5/130: 23% rage raid_movement, ignore_pain
4:22.953 auto_attack Fluffy_Pillow 30.7/130: 24% rage raid_movement, ignore_pain
4:22.953 revenge Fluffy_Pillow 30.7/130: 24% rage raid_movement, ignore_pain
4:24.407 shield_block Fluffy_Pillow 36.1/130: 28% rage ignore_pain
4:24.407 shield_slam Fluffy_Pillow 26.1/130: 20% rage ignore_pain, shield_block
4:25.862 intercept Fluffy_Pillow 46.5/130: 36% rage shield_block
4:26.110 thunder_clap Fluffy_Pillow 57.8/130: 44% rage shield_block
4:27.564 devastate Fluffy_Pillow 59.1/130: 45% rage shield_block
4:29.018 ignore_pain Alacastria 62.1/130: 48% rage raid_movement, shield_block
4:29.018 devastate Fluffy_Pillow 2.1/130: 2% rage raid_movement, renewed_fury, ignore_pain, shield_block
4:30.472 devastate Fluffy_Pillow 2.3/130: 2% rage renewed_fury, ignore_pain, shield_block
4:31.926 arcane_torrent Fluffy_Pillow 2.3/130: 2% rage renewed_fury, ignore_pain
4:31.926 revenge Fluffy_Pillow 17.3/130: 13% rage renewed_fury, ignore_pain
4:33.380 shield_slam Fluffy_Pillow 22.5/130: 17% rage renewed_fury, ignore_pain
4:34.835 thunder_clap Fluffy_Pillow 42.9/130: 33% rage renewed_fury, ignore_pain
4:36.289 devastate Fluffy_Pillow 43.2/130: 33% rage ignore_pain
4:37.742 shield_block Fluffy_Pillow 43.2/130: 33% rage ignore_pain
4:37.742 devastate Fluffy_Pillow 33.2/130: 26% rage ignore_pain, shield_block
4:39.196 devastate Fluffy_Pillow 33.4/130: 26% rage ignore_pain, shield_block
4:40.650 revenge Fluffy_Pillow 33.6/130: 26% rage ignore_pain, shield_block
4:42.105 shield_slam Fluffy_Pillow 38.8/130: 30% rage ignore_pain, shield_block
4:43.558 devastate Fluffy_Pillow 58.8/130: 45% rage ignore_pain, shield_block
4:45.012 devastate Fluffy_Pillow 58.9/130: 45% rage raid_movement, shield_block
4:46.469 intercept Fluffy_Pillow 62.8/130: 48% rage
4:46.469 ignore_pain Alacastria 72.8/130: 56% rage
4:46.469 shield_slam Fluffy_Pillow 12.8/130: 10% rage renewed_fury, ignore_pain
4:47.922 devastate Fluffy_Pillow 32.8/130: 25% rage renewed_fury, ignore_pain
4:49.377 devastate Fluffy_Pillow 33.2/130: 26% rage renewed_fury, ignore_pain
4:50.831 Waiting 2.200 sec 33.5/130: 26% rage raid_movement, renewed_fury, ignore_pain
4:53.031 auto_attack Fluffy_Pillow 34.0/130: 26% rage raid_movement, ignore_pain
4:53.031 revenge Fluffy_Pillow 34.0/130: 26% rage raid_movement, ignore_pain
4:54.487 shield_block Fluffy_Pillow 39.2/130: 30% rage ignore_pain
4:54.487 thunder_clap Fluffy_Pillow 29.2/130: 22% rage ignore_pain, shield_block
4:55.942 shield_slam Fluffy_Pillow 29.2/130: 22% rage ignore_pain, shield_block
4:57.399 devastate Fluffy_Pillow 49.8/130: 38% rage dragon_scales, ignore_pain, shield_block
4:58.854 devastate Fluffy_Pillow 50.0/130: 38% rage dragon_scales, ignore_pain, shield_block
5:00.309 Waiting 0.200 sec 50.4/130: 39% rage raid_movement, dragon_scales, ignore_pain, shield_block
5:00.509 shield_slam Fluffy_Pillow 50.4/130: 39% rage raid_movement, dragon_scales, ignore_pain, shield_block
5:01.964 use_item_giant_ornamental_pearl Fluffy_Pillow 70.4/130: 54% rage dragon_scales, shield_block
5:01.964 ignore_pain Alacastria 70.4/130: 54% rage dragon_scales, shield_block, gaseous_bubble
5:01.964 revenge Fluffy_Pillow 10.4/130: 8% rage renewed_fury, ignore_pain, shield_block, gaseous_bubble
5:03.418 thunder_clap Fluffy_Pillow 15.4/130: 12% rage renewed_fury, ignore_pain, shield_block, gaseous_bubble
5:04.872 battle_cry Fluffy_Pillow 15.9/130: 12% rage renewed_fury, ignore_pain
5:04.872 neltharions_fury Fluffy_Pillow 15.9/130: 12% rage renewed_fury, ignore_pain, battle_cry
5:06.377 intercept Fluffy_Pillow 16.4/130: 13% rage renewed_fury, ignore_pain, neltharions_fury, battle_cry
5:06.469 devastate Fluffy_Pillow 26.4/130: 20% rage renewed_fury, ignore_pain, neltharions_fury, battle_cry
5:07.922 shield_block Fluffy_Pillow 26.4/130: 20% rage renewed_fury, ignore_pain, battle_cry
5:07.922 shield_slam Fluffy_Pillow 16.4/130: 13% rage renewed_fury, ignore_pain, battle_cry, shield_block
5:09.378 thunder_clap Fluffy_Pillow 36.7/130: 28% rage ignore_pain, battle_cry, shield_block
5:10.833 devastate Fluffy_Pillow 36.9/130: 28% rage ignore_pain, shield_block
5:12.287 devastate Fluffy_Pillow 37.2/130: 29% rage ignore_pain, shield_block
5:13.742 revenge Fluffy_Pillow 37.2/130: 29% rage ignore_pain, shield_block
5:15.196 devastate Fluffy_Pillow 42.4/130: 33% rage ignore_pain, shield_block
5:16.651 shield_slam Fluffy_Pillow 42.5/130: 33% rage raid_movement, ignore_pain
5:18.105 ignore_pain Alacastria 66.0/130: 51% rage
5:18.105 devastate Fluffy_Pillow 6.0/130: 5% rage renewed_fury, ignore_pain
5:19.559 devastate Fluffy_Pillow 6.0/130: 5% rage renewed_fury, ignore_pain
5:21.012 devastate Fluffy_Pillow 6.4/130: 5% rage renewed_fury, ignore_pain
5:22.465 revenge Fluffy_Pillow 6.4/130: 5% rage renewed_fury, ignore_pain
5:23.921 shield_block Fluffy_Pillow 11.4/130: 9% rage renewed_fury, ignore_pain
5:23.921 devastate Fluffy_Pillow 1.4/130: 1% rage renewed_fury, ignore_pain, shield_block
5:25.376 shield_slam Fluffy_Pillow 1.4/130: 1% rage ignore_pain, shield_block
5:26.831 intercept Fluffy_Pillow 21.9/130: 17% rage ignore_pain, shield_block
5:26.831 devastate Fluffy_Pillow 31.9/130: 25% rage ignore_pain, shield_block
5:28.285 devastate Fluffy_Pillow 32.0/130: 25% rage ignore_pain, shield_block
5:29.740 shield_slam Fluffy_Pillow 32.0/130: 25% rage ignore_pain, shield_block
5:31.193 devastate Fluffy_Pillow 52.2/130: 40% rage ignore_pain, shield_block
5:32.648 auto_attack Fluffy_Pillow 52.4/130: 40% rage raid_movement, ignore_pain, shield_block
5:32.648 shield_slam Fluffy_Pillow 52.4/130: 40% rage raid_movement, ignore_pain, shield_block
5:34.101 ignore_pain Alacastria 75.1/130: 58% rage shield_block
5:34.101 devastate Fluffy_Pillow 15.1/130: 12% rage renewed_fury, ignore_pain, shield_block
5:35.556 devastate Fluffy_Pillow 15.2/130: 12% rage renewed_fury, ignore_pain
5:37.014 shield_block Fluffy_Pillow 15.5/130: 12% rage renewed_fury, ignore_pain
5:37.014 devastate Fluffy_Pillow 5.5/130: 4% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
5:38.469 revenge Fluffy_Pillow 5.8/130: 4% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
5:39.924 devastate Fluffy_Pillow 11.2/130: 9% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
5:41.377 shield_slam Fluffy_Pillow 11.5/130: 9% rage ignore_pain, shield_block, mark_of_the_heavy_hide
5:42.832 devastate Fluffy_Pillow 31.6/130: 24% rage ignore_pain, shield_block, mark_of_the_heavy_hide
5:44.288 devastate Fluffy_Pillow 31.9/130: 25% rage ignore_pain, shield_block, mark_of_the_heavy_hide
5:45.742 devastate Fluffy_Pillow 32.0/130: 25% rage ignore_pain, mark_of_the_heavy_hide
5:47.196 intercept Fluffy_Pillow 32.3/130: 25% rage ignore_pain
5:47.196 revenge Fluffy_Pillow 42.3/130: 33% rage ignore_pain
5:48.651 devastate Fluffy_Pillow 47.7/130: 37% rage raid_movement, ignore_pain
5:50.105 shield_block Fluffy_Pillow 52.6/130: 40% rage
5:50.105 shield_slam Fluffy_Pillow 42.6/130: 33% rage shield_block
5:51.558 ignore_pain Alacastria 63.9/130: 49% rage shield_block
5:51.558 devastate Fluffy_Pillow 3.9/130: 3% rage renewed_fury, ignore_pain, shield_block
5:53.012 devastate Fluffy_Pillow 4.0/130: 3% rage renewed_fury, dragon_scales, ignore_pain, shield_block
5:54.466 devastate Fluffy_Pillow 4.2/130: 3% rage renewed_fury, dragon_scales, ignore_pain, shield_block
5:55.921 shield_slam Fluffy_Pillow 4.4/130: 3% rage renewed_fury, dragon_scales, ignore_pain, shield_block
5:57.374 devastate Fluffy_Pillow 24.6/130: 19% rage renewed_fury, dragon_scales, ignore_pain, shield_block
5:58.828 devastate Fluffy_Pillow 24.8/130: 19% rage dragon_scales, ignore_pain, shield_block
6:00.284 devastate Fluffy_Pillow 25.2/130: 19% rage dragon_scales, ignore_pain
6:01.740 use_item_giant_ornamental_pearl Fluffy_Pillow 25.2/130: 19% rage dragon_scales, ignore_pain
6:01.964 arcane_torrent Fluffy_Pillow 25.2/130: 19% rage dragon_scales, ignore_pain, gaseous_bubble
6:01.964 revenge Fluffy_Pillow 40.2/130: 31% rage dragon_scales, ignore_pain, gaseous_bubble
6:03.419 shield_block Fluffy_Pillow 45.2/130: 35% rage dragon_scales, ignore_pain, gaseous_bubble
6:03.419 shield_slam Fluffy_Pillow 35.2/130: 27% rage dragon_scales, ignore_pain, shield_block, gaseous_bubble
6:04.874 devastate Fluffy_Pillow 55.2/130: 42% rage raid_movement, ignore_pain, shield_block, gaseous_bubble
6:06.328 battle_cry Fluffy_Pillow 55.2/130: 42% rage ignore_pain, shield_block, gaseous_bubble
6:06.328 demoralizing_shout Fluffy_Pillow 55.2/130: 42% rage ignore_pain, battle_cry, shield_block, gaseous_bubble
6:06.328 ignore_pain Alacastria 105.2/130: 81% rage demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble
6:06.328 devastate Fluffy_Pillow 45.2/130: 35% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble
6:07.783 intercept Fluffy_Pillow 45.2/130: 35% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble
6:07.783 devastate Fluffy_Pillow 55.2/130: 42% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble
6:09.238 shield_slam Fluffy_Pillow 55.2/130: 42% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble
6:10.692 ignore_pain Alacastria 75.3/130: 58% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block
6:10.692 devastate Fluffy_Pillow 15.3/130: 12% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block
6:12.147 potion Fluffy_Pillow 15.5/130: 12% rage renewed_fury, demoralizing_shout, ignore_pain, shield_block
6:12.147 devastate Fluffy_Pillow 15.5/130: 12% rage renewed_fury, demoralizing_shout, ignore_pain, shield_block, unbending_potion
6:13.603 devastate Fluffy_Pillow 15.5/130: 12% rage renewed_fury, demoralizing_shout, ignore_pain, unbending_potion
6:15.060 revenge Fluffy_Pillow 15.8/130: 12% rage renewed_fury, ignore_pain, unbending_potion
6:16.515 shield_block Fluffy_Pillow 21.5/130: 17% rage renewed_fury, ignore_pain, unbending_potion
6:16.515 shield_slam Fluffy_Pillow 11.5/130: 9% rage renewed_fury, ignore_pain, shield_block, unbending_potion
6:17.972 devastate Fluffy_Pillow 31.5/130: 24% rage ignore_pain, shield_block, unbending_potion
6:19.426 devastate Fluffy_Pillow 31.8/130: 24% rage ignore_pain, shield_block, unbending_potion
6:20.880 devastate Fluffy_Pillow 31.9/130: 25% rage raid_movement, ignore_pain, shield_block, unbending_potion
6:22.334 shield_slam Fluffy_Pillow 32.2/130: 25% rage ignore_pain, shield_block, unbending_potion
6:23.787 devastate Fluffy_Pillow 52.2/130: 40% rage ignore_pain, shield_block, unbending_potion
6:25.240 devastate Fluffy_Pillow 52.7/130: 41% rage ignore_pain, shield_block, unbending_potion
6:26.695 revenge Fluffy_Pillow 55.0/130: 42% rage unbending_potion
6:28.149 intercept Fluffy_Pillow 63.8/130: 49% rage unbending_potion
6:28.149 ignore_pain Alacastria 73.8/130: 57% rage unbending_potion
6:28.149 devastate Fluffy_Pillow 13.8/130: 11% rage renewed_fury, ignore_pain, unbending_potion
6:29.603 shield_block Fluffy_Pillow 13.8/130: 11% rage renewed_fury, ignore_pain, unbending_potion
6:29.603 shield_slam Fluffy_Pillow 3.8/130: 3% rage renewed_fury, ignore_pain, shield_block, unbending_potion
6:31.057 devastate Fluffy_Pillow 24.0/130: 18% rage renewed_fury, ignore_pain, shield_block, unbending_potion

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 22715 21090 10861 (8941)
Agility 6579 6254 0
Stamina 41306 41306 19030
Intellect 5328 5003 0
Spirit 2 2 0
Health 2478360 2478360 0
Rage 130 130 0
Crit 12.08% 12.08% 2129
Haste 3.41% 3.41% 1107
Damage / Heal Versatility 15.80% 14.86% 5945
Mitigation Versatility 7.90% 7.43% 5945
Attack Power 30563 28377 0
Mastery 51.83% 51.83% 9292
Armor 4256 4256 4015
Run Speed 7 0 0
Leech 2.39% 2.39% 549
Avoidance 0 0 404
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 17.05% 15.94% 2129
Tank-Block 30.56% 30.56% 0
Tank-Crit -6.00% -6.00% 0

Gear

Source Slot Average Item Level: 850.00
Local Head Subterranean Horror Faceguard
ilevel: 845, stats: { 548 Armor, +1238 StrInt, +1857 Sta, +777 Mastery, +503 Haste, +549 Leech }
Local Neck Krakentooth Necklace
ilevel: 860, stats: { +1201 Sta, +1307 Mastery, +599 Vers }, enchant: mark_of_the_heavy_hide
Local Shoulders Wardbreaker Pauldrons
ilevel: 845, stats: { 506 Armor, +929 StrInt, +1393 Sta, +625 Vers, +336 Mastery }, gems: { +200 Str }
Local Chest Demonsteel Breastplate of the Harmonious
ilevel: 845, stats: { 675 Armor, +1857 Sta, +1238 StrInt, +549 Mastery, +732 Vers }
Local Waist Greatbelt of Disruption
ilevel: 850, stats: { 384 Armor, +973 StrInt, +1459 Sta, +594 Vers, +385 Mastery }
Local Legs Arcane Defender's Pants
ilevel: 840, stats: { 584 Armor, +1182 StrInt, +1773 Sta, +899 Mastery, +359 Haste }
Local Feet Leadfoot Earthshakers
ilevel: 845, stats: { 464 Armor, +929 StrInt, +1393 Sta, +666 Mastery, +295 Vers }
Local Wrists Dragonbone Wristclamps
ilevel: 855, stats: { 302 Armor, +1147 Sta, +765 StrInt, +502 Mastery, +245 Haste }
Local Hands Coralplate Gauntlets
ilevel: 840, stats: { 417 Armor, +886 StrInt, +1329 Sta, +613 Mastery, +330 Vers }
Local Finger1 Braided Silver Ring
ilevel: 850, stats: { +1094 Sta, +997 Mastery, +839 Vers }, gems: { +150 Mastery }, enchant: { +200 Mastery }
Local Finger2 Loop of Eightfold Eyes
ilevel: 845, stats: { +1045 Sta, +1236 Mastery, +566 Vers }, enchant: { +200 Vers }
Local Trinket1 Giant Ornamental Pearl
ilevel: 850, stats: { +932 Vers }
Local Trinket2 Writhing Heart of Darkness
ilevel: 840, stats: { +404 Avoidance, +898 Crit }
Local Back Drape of the Mana-Starved
ilevel: 860, stats: { 135 Armor, +1201 Sta, +801 StrAgiInt, +528 Crit, +233 Vers }, enchant: { +200 Str }
Local Main Hand Scaleshard
ilevel: 868, weapon: { 3897 - 7239, 2.6 }, stats: { +657 Str, +986 Sta, +304 Crit, +292 Mastery }
Local Off Hand Scale of the Earth-Warder
ilevel: 868, stats: { +863 Str, +1295 Sta, +399 Crit, +383 Mastery }, relics: { +40 ilevels, +42 ilevels, +36 ilevels }

Talents

Level
15 Shockwave (Protection Warrior) Storm Bolt (Protection Warrior) Warbringer (Protection Warrior)
30 Impending Victory (Protection Warrior) Inspiring Presence (Protection Warrior) Safeguard (Protection Warrior)
45 Renewed Fury (Protection Warrior) Ultimatum (Protection Warrior) Avatar
60 Warlord's Challenge (Protection Warrior) Bounding Stride Crackling Thunder (Protection Warrior)
75 Best Served Cold (Protection Warrior) Never Surrender (Protection Warrior) Indomitable (Protection Warrior)
90 Vengeance (Protection Warrior) Into the Fray (Protection Warrior) Booming Voice (Protection Warrior)
100 Anger Management Heavy Repercussions (Protection Warrior) Ravager (Protection Warrior)

Profile

warrior="Alacastria"
origin="https://us.api.battle.net/wow/character/thrall/Alacastria/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/45/155500077-avatar.jpg"
level=110
race=blood_elf
role=tank
position=front
professions=blacksmithing=758/mining=784
talents=1213332
artifact=11:0:0:0:0:91:1:93:1:95:3:98:2:99:1:100:3:101:3:102:3:103:1:104:1:1358:1
spec=protection

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=countless_armies
actions.precombat+=/food,type=seedbattered_fish_plate
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=unbending_potion

# Executed every time the actor is available.
actions=intercept
actions+=/auto_attack
actions+=/use_item,name=giant_ornamental_pearl
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/call_action_list,name=prot

actions.prot=shield_block,if=!buff.neltharions_fury.up&((cooldown.shield_slam.remains<6&!buff.shield_block.up)|(cooldown.shield_slam.remains<6+buff.shield_block.remains&buff.shield_block.up))
actions.prot+=/ignore_pain,if=(rage>=60&!talent.vengeance.enabled)|(buff.vengeance_ignore_pain.up&buff.ultimatum.up)|(buff.vengeance_ignore_pain.up&rage>=39)|(talent.vengeance.enabled&!buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage<30)
actions.prot+=/focused_rage,if=(buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(buff.ultimatum.up&buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(talent.vengeance.enabled&buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up)|(talent.vengeance.enabled&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage>=30)|(buff.ultimatum.up&buff.vengeance_ignore_pain.up&cooldown.shield_slam.remains=0&rage<10)|(rage>=100)
actions.prot+=/demoralizing_shout,if=incoming_damage_2500ms>health.max*0.20
actions.prot+=/shield_wall,if=incoming_damage_2500ms>health.max*0.50
actions.prot+=/last_stand,if=incoming_damage_2500ms>health.max*0.50&!cooldown.shield_wall.remains=0
actions.prot+=/potion,name=unbending_potion,if=(incoming_damage_2500ms>health.max*0.15&!buff.potion.up)|target.time_to_die<=25
actions.prot+=/call_action_list,name=prot_aoe,if=spell_targets.neltharions_fury>=2
actions.prot+=/focused_rage,if=talent.ultimatum.enabled&buff.ultimatum.up&!talent.vengeance.enabled
actions.prot+=/battle_cry,if=(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
actions.prot+=/demoralizing_shout,if=talent.booming_voice.enabled&buff.battle_cry.up
actions.prot+=/ravager,if=talent.ravager.enabled&buff.battle_cry.up
actions.prot+=/neltharions_fury,if=incoming_damage_2500ms>health.max*0.20&!buff.shield_block.up
actions.prot+=/shield_slam,if=!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
actions.prot+=/revenge,if=cooldown.shield_slam.remains<=gcd.max*2
actions.prot+=/devastate

actions.prot_aoe=focused_rage,if=talent.ultimatum.enabled&buff.ultimatum.up&!talent.vengeance.enabled
actions.prot_aoe+=/battle_cry,if=(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
actions.prot_aoe+=/demoralizing_shout,if=talent.booming_voice.enabled&buff.battle_cry.up
actions.prot_aoe+=/ravager,if=talent.ravager.enabled&buff.battle_cry.up
actions.prot_aoe+=/neltharions_fury,if=buff.battle_cry.up
actions.prot_aoe+=/shield_slam,if=!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
actions.prot_aoe+=/revenge
actions.prot_aoe+=/thunder_clap,if=spell_targets.thunder_clap>=3
actions.prot_aoe+=/devastate

head=subterranean_horror_faceguard,id=134511,bonus_id=1727/41/1497/3336
neck=krakentooth_necklace,id=141473,bonus_id=1472,enchant=mark_of_the_heavy_hide
shoulders=wardbreaker_pauldrons,id=136730,bonus_id=1727/1808/1507/3336,gems=200str
back=drape_of_the_manastarved,id=141543,bonus_id=1472,enchant=200str
chest=demonsteel_breastplate,id=123910,bonus_id=689/1715/3408/601/668
wrists=dragonbone_wristclamps,id=138218,bonus_id=1807/1477/3336
hands=coralplate_gauntlets,id=134224,bonus_id=3397/1502/3336
waist=greatbelt_of_disruption,id=137310,bonus_id=3410/1502/3336
legs=arcane_defenders_pants,id=134271,bonus_id=1727/1502/1813
feet=leadfoot_earthshakers,id=134507,bonus_id=1727/1497/3336
finger1=braided_silver_ring,id=134539,bonus_id=3412/1808/1502/1813,gems=150mastery,enchant=200mastery
finger2=loop_of_eightfold_eyes,id=134527,bonus_id=1726/1497/3337,enchant=200vers
trinket1=giant_ornamental_pearl,id=137369,bonus_id=3413/1502/1813
trinket2=writhing_heart_of_darkness,id=137315,bonus_id=1727/40/1492/1813
main_hand=scaleshard,id=128288
off_hand=scale_of_the_earthwarder,id=128289,bonus_id=752,gem_id=136778/137412/137546/0,relic_id=1727:1492:1813/1727:1497:3336/1726:1477/0

# Gear Summary
# gear_ilvl=850.38
# gear_strength=10861
# gear_stamina=19030
# gear_crit_rating=2129
# gear_haste_rating=1107
# gear_mastery_rating=9292
# gear_versatility_rating=5945
# gear_leech_rating=549
# gear_avoidance_rating=404
# gear_armor=4015

Healing_Target : 0 dps, 0 dps to main target, 0 dtps, 0 hps (0 aps), 62.3k TMI, 55.2k ETMI

Results, Spec and Gear

DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max MSD Freq.   Window Bin Size
0.0 0.00 / 0.00% 0 / 0.0%       62.3k 26 / 0.04% 61.1k 65.8k 4.2k / 6.7%       0.0% 0.0% 0.0% INF       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Health 97.63% 0.0 100.0% 100%
Talents
Scale Factors for Healing_Target Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Scale Factors for other metrics

Scale Factors for Healing_Target Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_Target Priority Target Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_Target Damage Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_Target Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_Target Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_Target Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_Target Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_Target Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_Target Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_Target Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_TargetTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 50.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:Healing_Target
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.53% 14.53% 2.0(2.0) 0.0

Buff details

  • buff initial source:Healing_Target
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Shield of Vengeance 2.5 0.0 200.3sec 200.0sec 9.12% 9.12% 0.0(0.0) 2.4

Buff details

  • buff initial source:Healing_Target
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • shield_of_vengeance_1:9.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:101.00%
Constant Buffs
Health Decade (90 - 100)

Buff details

  • buff initial source:Healing_Target
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%
bleeding

Buff details

  • buff initial source:Healing_Target
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Healing_Target
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Healing_Target
Resource RPS-Gain RPS-Loss
Health 16640.86 0.00
Combat End Resource Mean Min Max
Health 20000000.00 20000000.00 20000000.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Healing_Target Fight Length
Count 9999
Mean 400.62
Minimum 307.54
Maximum 499.01
Spread ( max - min ) 191.47
Range [ ( max - min ) / 2 * 100% ] 23.90%
DPS
Sample Data Healing_Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data Healing_Target Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Healing_Target Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Healing_Target Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Healing_Target Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS
Sample Data Healing_Target Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Healing_Target Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Healing_Target Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Healing_Target Healing Taken Per Second
Count 9999
Mean 16883.06
Minimum 13359.68
Maximum 21677.26
Spread ( max - min ) 8317.58
Range [ ( max - min ) / 2 * 100% ] 24.63%
Standard Deviation 2046.2484
5th Percentile 14019.98
95th Percentile 20463.58
( 95th Percentile - 5th Percentile ) 6443.61
Mean Distribution
Standard Deviation 20.4635
95.00% Confidence Intervall ( 16842.95 - 16923.17 )
Normalized 95.00% Confidence Intervall ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 564
0.1% Error 56430
0.1 Scale Factor Error with Delta=300 35743
0.05 Scale Factor Error with Delta=300 142975
0.01 Scale Factor Error with Delta=300 3574377
TMI
Sample Data Healing_Target Theck-Meloree Index
Count 9999
Mean 62324.97
Minimum 61080.77
Maximum 65832.99
Spread ( max - min ) 4752.22
Range [ ( max - min ) / 2 * 100% ] 3.81%
Standard Deviation 1345.4819
5th Percentile 61147.03
95th Percentile 65088.85
( 95th Percentile - 5th Percentile ) 3941.82
Mean Distribution
Standard Deviation 13.4555
95.00% Confidence Intervall ( 62298.59 - 62351.34 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1790
0.1 Scale Factor Error with Delta=300 15453
0.05 Scale Factor Error with Delta=300 61815
0.01 Scale Factor Error with Delta=300 1545394
ETMI
Sample Data Healing_TargetTheck-Meloree Index (Effective)
Count 9999
Mean 55224.40
Minimum 53432.71
Maximum 60310.19
Spread ( max - min ) 6877.48
Range [ ( max - min ) / 2 * 100% ] 6.23%
Standard Deviation 1400.9387
5th Percentile 53764.40
95th Percentile 58030.81
( 95th Percentile - 5th Percentile ) 4266.41
Mean Distribution
Standard Deviation 14.0101
95.00% Confidence Intervall ( 55196.94 - 55251.86 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2472
0.1 Scale Factor Error with Delta=300 16754
0.05 Scale Factor Error with Delta=300 67016
0.01 Scale Factor Error with Delta=300 1675413
MSD
Sample Data Healing_Target Max Spike Value
Count 2503
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Sample Sequence

Sample Sequence Table

time name target resources buffs
0:12.000 Waiting 385.000 sec 14705197.3/20000000: 74% health bloodlust, raid_movement, shield_of_vengeance

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 20000000 0
Crit 0.00% 5.00% 0
Haste INF% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 0 1536 1536
Tank-Miss 0.00% 3.00% 0
Tank-Dodge 0.00% 3.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

unknown="Healing_Target"
level=100
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown


# Gear Summary
# gear_ilvl=0.00

Simulation & Raid Information

Iterations: 10003
Threads: 4
Confidence: 95.00%
Fight Length: 308 - 499 ( 400.6 )

Performance:

Total Events Processed: 949397928
Max Event Queue: 494
Sim Seconds: 4007404
CPU Seconds: 952.4219
Physical Seconds: 249.6290
Speed Up: 4208

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Mortwraith Mortwraith annihilation 201427 6737152 16817 5.20 133372 290953 17.3 34.7 38.6% 0.0% 0.0% 0.0% 16.90sec 6737152 400.62sec
Mortwraith Mortwraith augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Mortwraith Mortwraith auto_attack_mh 0 3245563 8101 19.66 20658 41317 131.3 131.3 38.6% 18.9% 0.0% 0.0% 3.05sec 4771285 400.62sec
Mortwraith Mortwraith auto_attack_oh 1 1622491 4050 19.66 10329 20660 131.3 131.3 38.6% 19.0% 0.0% 0.0% 3.05sec 2385216 400.62sec
Mortwraith Mortwraith blade_dance 188499 18630939 46505 62.74 32075 64191 18.3 418.9 38.6% 0.0% 0.0% 0.0% 15.64sec 27389245 400.62sec
Mortwraith Mortwraith blur 198589 0 0 0.00 0 0 0.1 0.0 0.0% 0.0% 0.0% 0.0% 179.85sec 0 400.62sec
Mortwraith Mortwraith chaos_strike 162794 22826447 56978 23.14 101553 221399 77.3 154.5 38.5% 0.0% 0.0% 0.0% 4.76sec 22826447 400.62sec
Mortwraith Mortwraith consume_magic 183752 0 0 0.00 0 0 12.6 0.0 0.0% 0.0% 0.0% 0.0% 32.59sec 0 400.62sec
Mortwraith Mortwraith death_sweep 210152 8376059 20908 18.69 48467 96887 5.4 124.8 38.5% 0.0% 0.0% 0.0% 56.77sec 12313600 400.62sec
Mortwraith Mortwraith demons_bite 162243 6503875 16235 13.32 52766 105530 88.9 88.9 38.6% 0.0% 0.0% 0.0% 4.45sec 9561313 400.62sec
Mortwraith Mortwraith eye_beam ticks -198013 27543434 68859 16.73 0 49257 11.8 111.5 100.0% 0.0% 0.0% 0.0% 32.88sec 27543434 400.62sec
Mortwraith Mortwraith anguish 202446 11613022 28988 8.68 144528 289446 0.0 57.9 38.6% 0.0% 0.0% 0.0% 0.00sec 11613022 400.62sec
Mortwraith Mortwraith fel_barrage 211053 19533887 48759 23.80 88713 177408 10.1 158.9 38.6% 0.0% 0.0% 0.0% 41.31sec 19533887 400.62sec
Mortwraith Mortwraith fel_rush 195072 21805115 54428 17.84 131953 263931 34.4 119.1 38.7% 0.0% 0.0% 0.0% 11.84sec 21805115 400.62sec
Mortwraith Mortwraith flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Mortwraith Mortwraith food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Mortwraith Mortwraith fury_of_the_illidari ticks -201467 18562530 46406 7.40 29880 59758 7.1 49.4 38.6% 0.0% 0.0% 0.0% 60.48sec 18562530 400.62sec
Mortwraith Mortwraith rage_of_the_illidari 217070 11128915 27779 4.77 349223 0 7.0 31.9 0.0% 0.0% 0.0% 0.0% 60.48sec 11128915 400.62sec
Mortwraith Mortwraith metamorphosis 191427 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 241.60sec 0 400.62sec
Mortwraith Mortwraith metamorphosis_impact 200166 732481 1828 1.05 75696 151424 2.0 7.0 38.5% 0.0% 0.0% 0.0% 241.60sec 732481 400.62sec
Mortwraith Mortwraith potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Mortwraith Mortwraith potion_of_the_old_war 188028 4985287 12444 3.72 144650 289476 24.8 24.8 38.7% 0.0% 0.0% 0.0% 11.64sec 7328844 400.62sec
Mortwraith Mortwraith throw_glaive 185123 16999536 42433 16.25 113042 226056 47.8 108.5 38.6% 0.0% 0.0% 0.0% 8.41sec 24990928 400.62sec
Mortwraith Mortwraith bloodlet ticks -207690 20910804 52277 52.81 59392 0 0.0 352.1 0.0% 0.0% 0.0% 0.0% 0.00sec 20910804 400.62sec
Mortwraith Mortwraith vengeful_retreat 198793 2138610 5338 13.29 17384 34768 25.4 88.8 38.6% 0.0% 0.0% 0.0% 15.89sec 3143959 400.62sec
Táunks Táunks annihilation 201427 6805419 16987 5.71 115730 259179 19.1 38.2 43.7% 0.0% 0.0% 0.0% 15.88sec 6805419 400.62sec
Táunks Táunks augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Táunks Táunks auto_attack_mh 0 3293363 8221 20.89 18932 37867 139.5 139.5 43.7% 19.0% 0.0% 0.0% 2.87sec 4841555 400.62sec
Táunks Táunks auto_attack_oh 1 1646597 4110 20.89 9468 18932 139.5 139.5 43.7% 19.0% 0.0% 0.0% 2.87sec 2420653 400.62sec
Táunks Táunks blade_dance 188499 18927002 47244 65.23 30225 60435 19.1 435.6 43.8% 0.0% 0.0% 0.0% 15.04sec 27824486 400.62sec
Táunks Táunks blur 198589 0 0 0.00 0 0 3.4 0.0 0.0% 0.0% 0.0% 0.0% 107.08sec 0 400.62sec
Táunks Táunks chaos_strike 162794 22379512 55862 24.30 89444 200367 81.2 162.3 43.7% 0.0% 0.0% 0.0% 4.49sec 22379512 400.62sec
Táunks Táunks consume_magic 183752 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 30.92sec 0 400.62sec
Táunks Táunks death_sweep 210152 6972409 17404 16.30 44549 89121 4.8 108.9 43.7% 0.0% 0.0% 0.0% 64.98sec 10250101 400.62sec
Táunks Táunks demon_blades 203796 6250109 15601 24.99 26067 52138 166.8 166.8 43.7% 0.0% 0.0% 0.0% 5.99sec 6250109 400.62sec
Táunks Táunks eye_beam ticks -198013 14596807 36492 10.75 0 45360 7.4 71.7 100.0% 0.0% 0.0% 0.0% 54.11sec 14596807 400.62sec
Táunks Táunks anguish 202446 6069690 15151 4.72 133960 267845 0.0 31.5 43.9% 0.0% 0.0% 0.0% 0.00sec 6069690 400.62sec
Táunks Táunks fel_barrage 211053 16519800 41236 21.68 79354 158653 9.3 144.7 43.9% 0.0% 0.0% 0.0% 44.93sec 16519800 400.62sec
Táunks Táunks fel_rush 195072 27862133 69547 24.14 120239 240496 42.5 161.2 43.7% 0.0% 0.0% 0.0% 9.52sec 27862133 400.62sec
Táunks Táunks flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Táunks Táunks food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Táunks Táunks fury_of_the_illidari ticks -201467 17131324 42828 7.41 26594 53203 7.1 49.4 43.7% 0.0% 0.0% 0.0% 60.41sec 17131324 400.62sec
Táunks Táunks inner_demons 202388 5971385 14905 2.71 229125 458014 7.0 18.1 43.9% 0.0% 0.0% 0.0% 53.23sec 5971385 400.62sec
Táunks Táunks metamorphosis 191427 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 243.85sec 0 400.62sec
Táunks Táunks metamorphosis_impact 200166 629162 1570 0.96 68321 136547 2.0 6.4 43.8% 0.0% 0.0% 0.0% 243.85sec 629162 400.62sec
Táunks Táunks potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Táunks Táunks potion_of_the_old_war 188028 4383169 10941 3.43 133325 266635 22.9 22.9 43.8% 0.0% 0.0% 0.0% 12.91sec 6443674 400.62sec
Táunks Táunks throw_glaive 185123 16684838 41648 16.90 102785 205648 49.6 112.9 43.8% 0.0% 0.0% 0.0% 8.10sec 24528293 400.62sec
Táunks Táunks bloodlet ticks -207690 20539331 51348 53.93 57133 0 0.0 359.5 0.0% 0.0% 0.0% 0.0% 0.00sec 20539331 400.62sec
Táunks Táunks vengeful_retreat 198793 1288556 3216 8.36 16064 32128 15.9 55.8 43.7% 0.0% 0.0% 0.0% 25.82sec 1894299 400.62sec
Illistan Illistan augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Illistan Illistan auto_attack_mh 0 3914068 9770 22.14 21365 42732 147.8 147.8 42.9% 19.0% 0.0% 6.0% 2.72sec 5885816 400.62sec
Illistan Illistan auto_attack_oh 1 1832248 4574 20.75 10680 21365 138.6 138.6 42.8% 19.0% 0.0% 6.1% 2.90sec 2755531 400.62sec
Illistan Illistan consume_soul_lesser 203794 0 0 0.00 0 0 64.4 0.0 0.0% 0.0% 0.0% 0.0% 6.15sec 0 400.62sec
Illistan Illistan demon_spikes 203720 0 0 0.00 0 0 36.1 0.0 0.0% 0.0% 0.0% 0.0% 11.18sec 0 400.62sec
Illistan Illistan empower_wards 218256 0 0 0.00 0 0 11.3 0.0 0.0% 0.0% 0.0% 0.0% 36.89sec 0 400.62sec
Illistan Illistan felblade 232893 4938842 12328 6.03 85817 171648 40.3 40.3 42.8% 0.0% 0.0% 7.5% 9.99sec 4938842 400.62sec
Illistan Illistan fiery_brand 204021 2258766 5638 1.06 223227 446453 7.1 7.1 42.9% 0.0% 0.0% 0.0% 60.61sec 2258766 400.62sec
Illistan Illistan flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Illistan Illistan food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Illistan Illistan immolation_aura 178740 29766932 74302 104.38 29889 59788 29.2 697.0 42.9% 0.0% 0.0% 0.0% 13.92sec 29766932 400.62sec
Illistan Illistan infernal_strike 189110 10335104 25798 10.74 100867 201752 21.3 71.7 42.9% 0.0% 0.0% 0.0% 20.10sec 10335104 400.62sec
Illistan Illistan potion 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Illistan Illistan shear 203782 13183208 32907 23.42 59014 118054 156.4 156.4 42.8% 0.0% 0.0% 7.5% 2.54sec 19826564 400.62sec
Illistan Illistan sigil_of_flame 204596 2629652 6564 5.22 52734 105462 13.3 34.9 43.0% 0.0% 0.0% 0.0% 31.01sec 4471249 400.62sec
Illistan Illistan sigil_of_flame ticks -204596 1841596 4604 10.33 18706 37414 13.3 68.9 42.9% 0.0% 0.0% 0.0% 31.01sec 4471249 400.62sec
Illistan Illistan soul_carver 207407 2215459 5530 2.12 109788 219325 7.1 14.1 42.8% 0.0% 0.0% 7.5% 60.64sec 3760020 400.62sec
Illistan Illistan soul_carver ticks -207407 1544561 3861 3.17 51157 102315 7.1 21.1 43.0% 0.0% 0.0% 0.0% 60.64sec 3760020 400.62sec
Illistan Illistan soul_cleave 228477 7472877 18653 6.64 117939 235868 44.4 44.4 42.9% 0.0% 0.0% 7.6% 8.99sec 11241215 400.62sec
Illistan Illistan soul_cleave_heal 228477 0 0 0.00 0 0 44.4 0.0 0.0% 0.0% 0.0% 0.0% 8.99sec 0 400.62sec
Oinkie Oinkie ashamanes_rip ticks -210705 3377154 8443 6.61 53924 109954 5.7 44.0 40.6% 0.0% 0.0% 0.0% 58.57sec 3377154 400.62sec
Oinkie Oinkie augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Oinkie Oinkie berserk 106951 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 181.95sec 0 400.62sec
Oinkie Oinkie cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Oinkie Oinkie cat_melee 0 11185493 27920 62.84 18766 38277 419.6 419.6 40.5% 0.0% 0.0% 0.0% 0.95sec 16008733 400.62sec
Oinkie Oinkie dash 1850 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 188.53sec 0 400.62sec
Oinkie Oinkie ferocious_bite 22568 1685377 4207 1.13 148597 334636 7.5 7.5 40.4% 0.0% 0.0% 0.0% 56.86sec 2378843 400.62sec
Oinkie Oinkie flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Oinkie Oinkie food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Oinkie Oinkie lunar_inspiration 155625 961306 2400 2.63 38469 78402 17.6 17.6 40.7% 0.0% 0.0% 0.0% 23.50sec 6929454 400.62sec
Oinkie Oinkie lunar_inspiration ticks -155625 5968148 14920 21.89 28774 58697 17.6 145.9 40.5% 0.0% 0.0% 0.0% 23.50sec 6929454 400.62sec
Oinkie Oinkie potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Oinkie Oinkie potion_of_the_old_war 188028 5690307 14204 3.56 168480 343577 23.8 23.8 40.6% 0.0% 0.0% 0.0% 14.42sec 8365290 400.62sec
Oinkie Oinkie rake 1822 1696671 4235 2.85 62837 128100 19.0 19.0 40.5% 0.0% 0.0% 0.0% 22.52sec 10006517 400.62sec
Oinkie Oinkie rake ticks -1822 8309846 20775 16.61 52793 107761 19.0 110.7 40.5% 0.0% 0.0% 0.0% 22.52sec 10006517 400.62sec
Oinkie Oinkie rip ticks -1079 15774473 39436 32.10 51890 105846 14.7 214.0 40.5% 0.0% 0.0% 0.0% 23.68sec 15774473 400.62sec
Oinkie Oinkie savage_roar 52610 0 0 0.00 0 0 14.4 0.0 0.0% 0.0% 0.0% 0.0% 28.80sec 0 400.62sec
Oinkie Oinkie shred 5221 7896289 19710 7.51 96738 197266 50.1 50.1 60.5% 0.0% 0.0% 0.0% 8.04sec 11239827 400.62sec
Oinkie Oinkie skull_bash 106839 0 0 0.00 0 0 13.5 0.0 0.0% 0.0% 0.0% 0.0% 30.41sec 0 400.62sec
Oinkie Oinkie swipe_cat 106785 29909093 74657 54.10 58290 118919 60.2 361.2 40.4% 0.0% 0.0% 0.0% 4.83sec 43708604 400.62sec
Oinkie Oinkie thrash_cat 106830 4029213 10057 20.42 20797 42432 22.7 136.3 40.5% 0.0% 0.0% 0.0% 13.02sec 14858593 400.62sec
Oinkie Oinkie thrash_cat ticks -106830 10829380 27073 82.18 13912 28375 22.7 547.8 40.5% 0.0% 0.0% 0.0% 13.02sec 14858593 400.62sec
Oinkie Oinkie tigers_fury 5217 0 0 0.00 0 0 13.6 0.0 0.0% 0.0% 0.0% 0.0% 30.32sec 0 400.62sec
Oinkie Oinkie wild_charge 102401 0 0 0.00 0 0 15.9 0.0 0.0% 0.0% 0.0% 0.0% 24.53sec 0 400.62sec
Rothlandra Rothlandra aimed_shot 19434 41327837 103160 17.40 231372 552325 116.3 116.2 38.8% 0.0% 0.0% 0.0% 3.43sec 60755834 400.62sec
Rothlandra Rothlandra legacy_of_the_windrunners 19434 7152464 17853 15.61 44623 107115 0.0 104.2 38.4% 0.0% 0.0% 0.0% 0.00sec 10514799 400.62sec
Rothlandra Rothlandra arcane_torrent 80483 0 0 0.00 0 0 4.8 0.0 0.0% 0.0% 0.0% 0.0% 91.02sec 0 400.62sec
Rothlandra Rothlandra augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Rothlandra Rothlandra auto_shot 0 6031929 15056 24.51 26765 58683 163.7 163.7 31.6% 0.0% 0.0% 0.0% 2.45sec 8867507 400.62sec
Rothlandra Rothlandra barrage ticks -120360 31575935 78940 44.20 22494 49159 19.3 294.6 29.9% 0.0% 0.0% 0.0% 21.26sec 46419615 400.62sec
Rothlandra Rothlandra deadly_grace 188091 3515978 8776 4.86 79979 188607 32.6 32.4 26.2% 0.0% 0.0% 0.0% 3.40sec 3515978 400.62sec
Rothlandra Rothlandra flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Rothlandra Rothlandra marked_shot 185901 50766925 126721 17.90 301950 652188 36.9 119.5 35.1% 0.0% 0.0% 0.0% 10.88sec 74632188 400.62sec
Rothlandra Rothlandra pepper_breath ticks -225622 1676295 4191 15.01 16973 0 20.1 100.0 0.0% 0.0% 0.0% 0.0% 19.78sec 1676295 400.62sec
Rothlandra Rothlandra potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Rothlandra Rothlandra sidewinders 214579 21837353 54509 23.21 106625 227729 45.2 155.0 28.3% 0.0% 0.0% 0.0% 8.91sec 21837353 400.62sec
Rothlandra Rothlandra trueshot 193526 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 134.53sec 0 400.62sec
Rothlandra Rothlandra windburst 204147 7959325 19868 2.51 352848 742931 15.8 16.8 31.3% 0.0% 0.0% 0.0% 24.54sec 11700962 400.62sec
Sarkul Sarkul aimed_shot 19434 39292226 98078 14.93 272049 639892 99.8 99.7 33.2% 0.0% 0.0% 0.0% 3.99sec 57763294 400.62sec
Sarkul Sarkul legacy_of_the_windrunners 19434 6740142 16824 13.41 51832 123124 0.0 89.5 32.9% 0.0% 0.0% 0.0% 0.00sec 9908647 400.62sec
Sarkul Sarkul augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Sarkul Sarkul auto_shot 0 5006335 12496 22.33 25379 55037 149.1 149.1 27.6% 0.0% 0.0% 0.0% 2.69sec 7359787 400.62sec
Sarkul Sarkul barrage ticks -120360 35588001 88970 46.47 25432 53724 19.4 309.8 25.7% 0.0% 0.0% 0.0% 21.17sec 52317733 400.62sec
Sarkul Sarkul blood_fury 20572 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 120.55sec 0 400.62sec
Sarkul Sarkul deadly_grace 188091 3223049 8045 4.50 80707 191849 30.4 30.1 23.9% 0.0% 0.0% 0.0% 6.39sec 3223049 400.62sec
Sarkul Sarkul flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Sarkul Sarkul mark_of_the_hidden_satyr 191259 1533140 3827 3.45 50459 109131 23.0 23.0 27.5% 0.0% 0.0% 0.0% 17.30sec 1533140 400.62sec
Sarkul Sarkul marked_shot 185901 54827664 136857 17.41 341734 714394 36.1 116.2 34.9% 0.0% 0.0% 0.0% 11.11sec 80601859 400.62sec
Sarkul Sarkul call_of_the_hunter 191070 4347653 10852 8.07 62590 132921 14.6 53.9 25.7% 0.0% 0.0% 0.0% 51.66sec 6391462 400.62sec
Sarkul Sarkul pepper_breath ticks -225622 1532823 3832 13.73 16975 0 18.4 91.5 0.0% 0.0% 0.0% 0.0% 21.49sec 1532823 400.62sec
Sarkul Sarkul potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Sarkul Sarkul rancid_maw 215405 4647927 11602 2.72 193161 420076 18.4 18.2 27.5% 0.0% 0.0% 0.0% 21.68sec 4647927 400.62sec
Sarkul Sarkul sidewinders 214579 18581130 46381 21.14 104046 217212 41.4 141.1 24.4% 0.0% 0.0% 0.0% 9.71sec 18581130 400.62sec
Sarkul Sarkul trueshot 193526 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 197.31sec 0 400.62sec
Sarkul Sarkul windburst 204147 8500821 21219 2.48 397392 827422 15.6 16.6 26.8% 0.0% 0.0% 0.0% 24.83sec 12497012 400.62sec
Mellarene Mellarene arcane_torrent 28730 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 117.49sec 0 400.62sec
Mellarene Mellarene augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Mellarene Mellarene combustion 190319 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 83.42sec 0 400.62sec
Mellarene Mellarene conflagration_dot ticks -226757 306481 766 26.62 1727 0 92.5 177.5 0.0% 0.0% 0.0% 0.0% 4.13sec 306481 400.62sec
Mellarene Mellarene conflagration_explosion 205023 8473537 21151 46.10 14034 34426 67.9 307.8 66.2% 0.0% 0.0% 0.0% 5.69sec 8473537 400.62sec
Mellarene Mellarene counterspell 2139 0 0 0.00 0 0 9.1 0.0 0.0% 0.0% 0.0% 0.0% 46.14sec 0 400.62sec
Mellarene Mellarene deadly_grace 188091 4320648 10785 3.13 85960 237907 20.9 20.9 79.6% 0.0% 0.0% 0.0% 5.47sec 4320648 400.62sec
Mellarene Mellarene fire_blast 108853 6159145 15374 6.80 0 135693 45.4 45.4 100.0% 0.0% 0.0% 0.0% 8.88sec 6159145 400.62sec
Mellarene Mellarene fireball 133 11295521 28195 13.86 64286 145738 92.7 92.5 71.0% 0.0% 0.0% 0.0% 4.13sec 11295521 400.62sec
Mellarene Mellarene flame_on 205029 0 0 0.00 0 0 5.7 0.0 0.0% 0.0% 0.0% 0.0% 80.06sec 0 400.62sec
Mellarene Mellarene flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Mellarene Mellarene food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Mellarene Mellarene ignite ticks -12846 20936046 52340 101.74 30867 0 303.4 678.3 0.0% 0.0% 0.0% 0.0% 1.36sec 20936046 400.62sec
Mellarene Mellarene living_bomb ticks -44457 4784905 11962 44.84 8499 20239 89.1 298.9 64.0% 0.0% 0.0% 0.0% 9.11sec 4784905 400.62sec
Mellarene Mellarene living_bomb_explosion 44461 24834783 61991 72.06 27246 65313 89.1 481.1 64.0% 0.0% 0.0% 0.0% 9.09sec 24834783 400.62sec
Mellarene Mellarene mark_of_the_hidden_satyr 191259 3669270 9159 3.20 86368 214936 21.3 21.3 66.6% 0.0% 0.0% 0.0% 18.62sec 3669270 400.62sec
Mellarene Mellarene phoenix_reborn 215773 1437218 3587 6.21 17407 43262 41.5 41.5 66.7% 0.0% 0.0% 0.0% 9.44sec 1437218 400.62sec
Mellarene Mellarene phoenixs_flames 194466 6117225 15269 2.90 0 315999 19.4 19.4 100.0% 0.0% 0.0% 0.0% 21.25sec 6117225 400.62sec
Mellarene Mellarene phoenixs_flames_splash 224637 4661475 11636 7.21 0 96822 19.4 48.1 100.0% 0.0% 0.0% 0.0% 21.28sec 4661475 400.62sec
Mellarene Mellarene potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Mellarene Mellarene pyroblast 11366 33153420 82755 14.67 144800 394215 97.1 97.9 77.7% 0.0% 0.0% 0.0% 4.13sec 33153420 400.62sec
Mellarene Mellarene rune_of_power 116011 0 0 0.00 0 0 8.8 0.0 0.0% 0.0% 0.0% 0.0% 50.35sec 0 400.62sec
Mellarene Mellarene scorch 2948 5182 13 0.02 0 50704 0.1 0.1 100.0% 0.0% 0.0% 0.0% 70.47sec 5182 400.62sec
Mellarene Mellarene tormenting_cyclone 221857 7080131 17673 45.87 12249 28738 12.7 306.3 65.9% 0.0% 0.0% 0.0% 30.55sec 7080131 400.62sec
Mellarene Mellarene volatile_ichor 222187 12219256 30501 8.57 114514 266477 17.0 57.2 65.2% 0.0% 0.0% 0.0% 23.05sec 12219256 400.62sec
Zipi Zipi augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Zipi Zipi blade_of_justice 184575 13974264 34882 7.61 185692 571653 50.8 50.8 23.2% 0.0% 0.0% 0.0% 7.90sec 20543491 400.62sec
Zipi Zipi blessing_of_might_proc 205729 12406496 30968 40.11 46329 0 362.9 267.8 0.0% 0.0% 0.0% 0.0% 2.00sec 12406496 400.62sec
Zipi Zipi crusade 231895 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 124.98sec 0 400.62sec
Zipi Zipi divine_storm 53385 38767434 96769 35.33 132412 270139 39.3 235.9 23.2% 0.0% 0.0% 0.0% 7.44sec 38767434 400.62sec
Zipi Zipi execution_sentence ticks -213757 9585182 23963 2.48 467249 953066 16.8 16.5 23.2% 0.0% 0.0% 0.0% 24.71sec 9585182 400.62sec
Zipi Zipi flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Zipi Zipi food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Zipi Zipi greater_blessing_of_might 203528 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Zipi Zipi judgment 20271 9732292 24293 6.63 177086 361741 44.3 44.3 23.2% 0.0% 0.0% 0.0% 9.06sec 9732292 400.62sec
Zipi Zipi judgment_aoe 228288 4828078 12052 3.43 169912 346669 44.3 22.9 23.2% 0.0% 0.0% 0.0% 9.06sec 4828078 400.62sec
Zipi Zipi melee 0 4746522 11848 17.20 33333 67973 114.8 114.8 23.1% 0.0% 0.0% 0.0% 3.48sec 6977837 400.62sec
Zipi Zipi potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Zipi Zipi potion_of_the_old_war 188028 5941988 14832 4.34 165255 337177 29.0 29.0 23.1% 0.0% 0.0% 0.0% 5.42sec 8735286 400.62sec
Zipi Zipi rebuke 96231 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 30.94sec 0 400.62sec
Zipi Zipi rend_flesh ticks -221770 1134600 2837 12.49 10988 22411 21.7 83.2 23.1% 0.0% 0.0% 0.0% 18.32sec 1134600 400.62sec
Zipi Zipi shield_of_vengeance 184662 0 0 0.67 0 0 4.5 4.5 22.6% 0.0% 0.0% 0.0% 100.23sec 3136344 400.62sec
Zipi Zipi shield_of_vengeance_proc 184689 0 0 0.00 0 0 4.5 0.0 0.0% 0.0% 0.0% 0.0% 99.95sec 0 400.62sec
Zipi Zipi templars_verdict 85256 12872329 32131 5.48 284068 579344 36.6 36.6 23.0% 0.0% 0.0% 0.0% 11.02sec 12872329 400.62sec
Zipi Zipi wake_of_ashes 205273 13837602 34540 8.02 208389 424930 13.3 53.5 23.2% 0.0% 0.0% 0.0% 31.30sec 19969484 400.62sec
Zipi Zipi wake_of_ashes ticks -205273 6131882 15330 23.15 32023 65324 13.3 154.4 23.1% 0.0% 0.0% 0.0% 31.30sec 19969484 400.62sec
Zipi Zipi zeal 217020 30022657 74940 43.38 72582 148168 118.1 289.6 41.1% 0.0% 0.0% 0.0% 3.38sec 44136149 400.62sec
Faelik Faelik augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Faelik Faelik deadly_grace 188091 3786983 9453 4.43 96571 193527 29.6 29.6 32.6% 0.0% 0.0% 0.0% 13.99sec 3786983 400.62sec
Faelik Faelik flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Faelik Faelik food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Faelik Faelik mark_of_the_hidden_satyr 191259 4209487 10507 4.59 103388 206933 30.7 30.7 32.7% 0.0% 0.0% 0.0% 12.95sec 4209487 400.62sec
Faelik Faelik mind_blast 8092 13156874 32841 8.61 172416 345356 56.5 57.5 32.7% 0.0% 0.0% 0.0% 7.01sec 13156874 400.62sec
Faelik Faelik mind_flay ticks -15407 6904146 17260 22.54 34575 69273 55.7 150.3 32.7% 0.0% 0.0% 0.0% 7.24sec 6904146 400.62sec
Faelik Faelik mind_sear ticks -48045 17379078 43448 12.39 28172 56346 34.7 82.6 32.8% 0.0% 0.0% 0.0% 8.19sec 17379078 400.62sec
Faelik Faelik potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Faelik Faelik power_infusion 10060 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 122.17sec 0 400.62sec
Faelik Faelik shadow_word_death 32379 1999097 4990 1.17 192261 384356 7.8 7.8 32.8% 0.0% 0.0% 0.0% 10.09sec 1999097 400.62sec
Faelik Faelik shadow_word_pain 589 2446848 6108 6.95 39727 79608 46.4 46.4 32.7% 0.0% 0.0% 0.0% 8.44sec 23883790 400.62sec
Faelik Faelik shadow_word_pain ticks -589 21436942 53592 50.18 48270 96612 46.4 334.5 32.7% 0.0% 0.0% 0.0% 8.44sec 23883790 400.62sec
Faelik Faelik sphere_of_insanity 194182 5196730 12972 55.80 13948 0 276.0 372.6 0.0% 0.0% 0.0% 0.0% 1.40sec 0 400.62sec
Faelik Faelik shadowfiend 34433 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 197.98sec 0 400.62sec
Faelik Faelik shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Faelik Faelik shadowy_apparitions 78203 7679821 19170 29.67 29027 58117 199.7 198.1 33.5% 0.0% 0.0% 0.0% 1.99sec 7679821 400.62sec
Faelik Faelik touch_of_the_grave 127802 1328119 3315 3.78 52577 0 25.3 25.3 0.0% 0.0% 0.0% 0.0% 16.10sec 1328119 400.62sec
Faelik Faelik vampiric_touch ticks -34914 50098338 125246 68.72 82329 164770 39.2 458.1 32.8% 0.0% 0.0% 0.0% 7.79sec 50098338 400.62sec
Faelik Faelik void_bolt 205448 22068351 55085 13.71 181534 363087 91.8 91.6 32.8% 0.0% 0.0% 0.0% 4.17sec 22068351 400.62sec
Faelik Faelik void_eruption 228360 4110245 10260 7.59 61167 122311 10.8 50.7 32.7% 0.0% 0.0% 0.0% 37.43sec 4110245 400.62sec
Faelik Faelik void_torrent ticks -205065 5857365 14643 5.55 119292 238331 6.8 37.0 32.8% 0.0% 0.0% 0.0% 62.10sec 5857365 400.62sec
Faelik Faelik_shadowfiend melee 0 3039154 109174 70.17 70331 140683 32.6 32.6 32.7% 0.0% 0.0% 0.0% 8.72sec 3039154 27.84sec
Faelik Faelik_shadowfiend shadowcrawl 63619 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 74.24sec 0 27.84sec
Raji Raji augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Raji Raji berserking 26297 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 186.10sec 0 400.62sec
Raji Raji deadly_grace 188091 3730013 9311 4.29 98070 196203 28.7 28.6 32.8% 0.0% 0.0% 0.0% 14.46sec 3730013 400.62sec
Raji Raji flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Raji Raji food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Raji Raji mind_blast 8092 9086085 22680 7.40 138569 277040 48.4 49.4 32.7% 0.0% 0.0% 0.0% 8.20sec 9086085 400.62sec
Raji Raji mind_flay ticks -15407 5399480 13499 18.93 32257 64490 47.7 126.2 32.7% 0.0% 0.0% 0.0% 8.44sec 5399480 400.62sec
Raji Raji mind_sear ticks -48045 15441555 38604 10.65 28745 57498 28.1 71.0 32.7% 0.0% 0.0% 0.0% 10.19sec 15441555 400.62sec
Raji Raji mindbender 200174 0 0 0.00 0 0 7.1 0.0 0.0% 0.0% 0.0% 0.0% 60.47sec 0 400.62sec
Raji Raji potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Raji Raji shadow_word_death 32379 3400618 8488 2.11 181470 363070 14.1 14.1 32.7% 0.0% 0.0% 0.0% 10.16sec 3400618 400.62sec
Raji Raji shadow_word_pain 589 1866845 4660 6.21 33910 67829 41.5 41.5 32.7% 0.0% 0.0% 0.0% 9.42sec 17489094 400.62sec
Raji Raji shadow_word_pain ticks -589 15622249 39056 44.47 39718 79431 41.5 296.5 32.7% 0.0% 0.0% 0.0% 9.42sec 17489094 400.62sec
Raji Raji shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Raji Raji shadowy_apparitions 78203 5879312 14676 24.83 26727 53441 167.2 165.8 32.7% 0.0% 0.0% 0.0% 2.36sec 5879312 400.62sec
Raji Raji vampiric_touch ticks -34914 31837058 79593 53.74 66949 133947 33.8 358.3 32.7% 0.0% 0.0% 0.0% 9.06sec 31837058 400.62sec
Raji Raji void_bolt 205448 19873193 49606 12.14 184753 369471 81.3 81.1 32.7% 0.0% 0.0% 0.0% 4.79sec 19873193 400.62sec
Raji Raji void_eruption 228360 3990595 9961 7.54 59767 119542 11.5 50.3 32.6% 0.0% 0.0% 0.0% 35.50sec 3990595 400.62sec
Raji Raji void_torrent ticks -205065 6117358 15293 6.37 108491 217261 6.9 42.5 32.7% 0.0% 0.0% 0.0% 61.27sec 6117358 400.62sec
Raji Raji volatile_ichor 222187 12505225 31215 11.09 127341 254615 21.9 74.1 32.6% 0.0% 0.0% 0.0% 17.95sec 12505225 400.62sec
Raji Raji_mindbender melee 0 6479494 61666 51.99 53605 107211 91.0 91.0 32.8% 0.0% 0.0% 0.0% 4.27sec 6479494 105.07sec
Raji Raji_mindbender shadowcrawl 63619 0 0 0.00 0 0 21.1 0.0 0.0% 0.0% 0.0% 0.0% 18.92sec 0 105.07sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 1948920 4872 6.95 31708 63416 9.2 46.3 32.7% 0.0% 0.0% 0.0% 40.27sec 1948920 64.00sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 416293 1041 1.49 31708 63416 2.0 9.9 32.5% 0.0% 0.0% 0.0% 58.70sec 416293 13.56sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 309004 773 1.10 31708 63416 1.4 7.3 32.7% 0.0% 0.0% 0.0% 6.42sec 309004 9.82sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 310287 776 1.12 31708 63416 1.3 7.5 30.5% 0.0% 0.0% 0.0% 4.32sec 310287 9.55sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 206103 515 0.90 31708 63416 1.0 6.0 8.3% 0.0% 0.0% 0.0% 0.00sec 206103 6.58sec
Vait Vait adrenaline_rush 13750 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 70.90sec 0 400.62sec
Vait Vait ambush 8676 1055010 2633 1.05 111693 224023 7.0 7.0 34.4% 0.0% 0.0% 0.0% 64.88sec 1550965 400.62sec
Vait Vait augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Vait Vait auto_attack_mh 0 8107485 20237 38.34 27023 54051 256.0 256.0 36.2% 19.0% 0.0% 0.0% 1.57sec 11918771 400.62sec
Vait Vait auto_attack_oh 1 3761225 9389 35.56 13515 27030 237.4 237.4 36.2% 19.0% 0.0% 0.0% 1.69sec 5529357 400.62sec
Vait Vait blade_flurry 13877 0 0 0.00 0 0 10.0 0.0 0.0% 0.0% 0.0% 0.0% 29.99sec 0 400.62sec
Vait Vait blade_flurry_attack 22482 32019513 79925 312.14 15363 0 416.8 2084.2 0.0% 0.0% 0.0% 0.0% 0.98sec 47071717 400.62sec
Vait Vait curse_of_the_dreadblades 202665 0 0 0.00 0 0 4.8 0.0 0.0% 0.0% 0.0% 0.0% 91.86sec 0 400.62sec
Vait Vait flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Vait Vait food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Vait Vait ghostly_strike 196937 1611564 4023 4.04 43851 87770 27.0 27.0 36.2% 0.0% 0.0% 0.0% 15.06sec 2369151 400.62sec
Vait Vait gouge 1776 0 0 0.00 0 0 19.9 0.0 0.0% 0.0% 0.0% 0.0% 18.27sec 0 400.62sec
Vait Vait greed 202822 13178388 32895 17.40 83168 166362 34.8 116.2 36.4% 0.0% 0.0% 0.0% 11.32sec 19373478 400.62sec
Vait Vait greed_oh 202823 6586339 16440 17.40 41584 83181 34.8 116.2 36.3% 0.0% 0.0% 0.0% 11.32sec 9682543 400.62sec
Vait Vait main_gauche 86392 9582287 23919 36.04 29247 58497 240.6 240.6 36.2% 0.0% 0.0% 0.0% 1.69sec 14086870 400.62sec
Vait Vait marked_for_death 137619 0 0 0.00 0 0 12.8 0.0 0.0% 0.0% 0.0% 0.0% 24.03sec 0 400.62sec
Vait Vait pistol_shot 185763 3021153 7541 6.54 44890 89775 43.7 43.7 54.2% 0.0% 0.0% 0.0% 8.62sec 4441381 400.62sec
Vait Vait potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Vait Vait potion_of_the_old_war 188028 4730447 11808 3.94 131881 264243 26.3 26.3 36.1% 0.0% 0.0% 0.0% 5.48sec 6954205 400.62sec
Vait Vait roll_the_bones 193316 0 0 0.00 0 0 16.3 0.0 0.0% 0.0% 0.0% 0.0% 24.49sec 0 400.62sec
Vait Vait run_through 2098 45570582 113750 14.87 336467 672485 99.3 99.3 36.4% 0.0% 0.0% 0.0% 4.00sec 66993072 400.62sec
Vait Vait saber_slash 193315 23670777 59085 32.48 80091 160195 216.9 216.9 36.3% 0.0% 0.0% 0.0% 1.84sec 34798285 400.62sec
Vait Vait sprint 2983 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 49.10sec 0 400.62sec
Vait Vait touch_of_the_grave 127802 1055528 2635 3.61 43757 0 24.1 24.1 0.0% 0.0% 0.0% 0.0% 16.89sec 1055528 400.62sec
Vait Vait vanish 1856 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 64.71sec 0 400.62sec
Bowflexn Bowflexn augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Bowflexn Bowflexn boulderfist 201897 14277840 35639 11.60 138478 282553 77.5 77.5 31.8% 0.0% 0.0% 0.0% 5.19sec 14277840 400.62sec
Bowflexn Bowflexn crash_lightning 187874 15371781 38370 39.13 44160 90082 64.9 261.3 31.9% 0.0% 0.0% 0.0% 6.11sec 15371781 400.62sec
Bowflexn Bowflexn crashing_storm 210801 15410788 38467 251.75 6876 14028 403.1 1680.9 32.0% 0.0% 0.0% 0.0% 0.98sec 15410788 400.62sec
Bowflexn Bowflexn doom_winds 204945 0 0 0.00 0 0 6.9 0.0 0.0% 0.0% 0.0% 0.0% 62.34sec 0 400.62sec
Bowflexn Bowflexn feral_spirit 51533 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 120.37sec 0 400.62sec
Bowflexn Bowflexn flametongue 193796 2695664 6729 4.55 66564 135787 30.4 30.4 32.1% 0.0% 0.0% 0.0% 13.27sec 2695664 400.62sec
Bowflexn Bowflexn flametongue_attack 10444 8976317 22406 164.21 6141 12528 1096.5 1096.5 32.0% 0.0% 0.0% 0.0% 1.15sec 8976317 400.62sec
Bowflexn Bowflexn flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Bowflexn Bowflexn food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Bowflexn Bowflexn frostbrand 196834 1676171 4184 3.67 51292 104627 24.5 24.5 32.0% 0.0% 0.0% 0.0% 16.56sec 1676171 400.62sec
Bowflexn Bowflexn hailstorm 210854 22143312 55273 160.81 15473 31568 1073.7 1073.7 32.0% 0.0% 0.0% 0.0% 1.18sec 22143312 400.62sec
Bowflexn Bowflexn lava_lash 60103 2496815 6232 2.52 111512 227518 16.8 16.8 31.9% 0.0% 0.0% 0.0% 22.80sec 2496815 400.62sec
Bowflexn Bowflexn lava_lash_cl 195592 1938381 4838 4.93 44152 90060 8.0 32.9 32.0% 0.0% 0.0% 0.0% 29.56sec 1938381 400.62sec
Bowflexn Bowflexn main_hand 0 3899740 9734 24.87 20559 41954 166.1 166.1 32.0% 19.0% 0.0% 0.0% 2.42sec 5732987 400.62sec
Bowflexn Bowflexn mark_of_the_hidden_satyr 191259 4625536 11546 3.68 141487 288773 24.5 24.5 31.9% 0.0% 0.0% 0.0% 16.31sec 4625536 400.62sec
Bowflexn Bowflexn offhand 1 1945594 4856 24.79 10283 20983 165.5 165.5 32.0% 19.0% 0.0% 0.0% 2.42sec 2860207 400.62sec
Bowflexn Bowflexn potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Bowflexn Bowflexn potion_of_the_old_war 188028 3550323 8862 3.21 124290 253734 21.5 21.5 31.8% 0.0% 0.0% 0.0% 7.29sec 5219311 400.62sec
Bowflexn Bowflexn storm_tempests 214452 1647039 4111 26.26 7049 14381 175.3 175.3 32.0% 0.0% 0.0% 0.0% 1.65sec 1647039 400.62sec
Bowflexn Bowflexn stormlash 213307 6240046 15576 78.78 11862 0 526.0 526.0 0.0% 0.0% 0.0% 0.0% 1.82sec 6240046 400.62sec
Bowflexn Bowflexn stormstrike 17364 0 0 0.00 0 0 112.5 0.0 0.0% 0.0% 0.0% 0.0% 3.51sec 0 400.62sec
Bowflexn Bowflexn stormstrike_cl 195592 21531065 53744 54.70 44237 90236 81.6 365.2 32.0% 0.0% 0.0% 0.0% 3.58sec 21531065 400.62sec
Bowflexn Bowflexn stormstrike_mh 32175 26855696 67035 21.06 143279 292069 140.6 140.6 32.1% 0.0% 0.0% 0.0% 3.51sec 39480418 400.62sec
Bowflexn Bowflexn stormstrike_offhand 32176 13435163 33536 21.06 71624 146101 140.6 140.6 32.1% 0.0% 0.0% 0.0% 3.51sec 19750962 400.62sec
Bowflexn Bowflexn unleash_lava 199053 3617016 9029 10.33 39338 80256 69.3 69.0 32.0% 0.0% 0.0% 0.0% 8.57sec 3617016 400.62sec
Bowflexn Bowflexn unleash_lightning 199054 3606691 9003 10.29 39339 80256 69.1 68.7 32.1% 0.0% 0.0% 0.0% 8.58sec 3606691 400.62sec
Bowflexn Bowflexn wind_shear 57994 0 0 0.00 0 0 14.4 0.0 0.0% 0.0% 0.0% 0.0% 28.32sec 0 400.62sec
Bowflexn Bowflexn windfury_attack 25504 8932825 22297 40.98 24499 49993 273.6 273.6 32.0% 0.0% 0.0% 0.0% 3.56sec 13132099 400.62sec
Bowflexn Bowflexn windfury_attack_oh 33750 1083155 2704 4.37 27875 56865 29.2 29.2 31.9% 0.0% 0.0% 0.0% 26.76sec 1592340 400.62sec
Bowflexn Bowflexn_frost_wolf frozen_bite 224126 1746799 73416 23.73 140388 280833 9.4 9.4 32.2% 0.0% 0.0% 0.0% 35.84sec 1746799 23.79sec
Bowflexn Bowflexn_frost_wolf melee 0 1053074 44260 114.59 17537 35080 45.4 45.4 32.1% 0.0% 0.0% 0.0% 6.74sec 1548118 23.79sec
Bowflexn Bowflexn_frost_wolf snowstorm 198483 1967334 82685 100.39 37431 74878 15.5 39.8 32.0% 0.0% 0.0% 0.0% 19.34sec 1967334 23.79sec
Bowflexn Bowflexn_fiery_wolf fiery_jaws 224125 1173755 49559 24.04 93587 187151 9.5 9.5 32.2% 0.0% 0.0% 0.0% 36.13sec 2587103 23.68sec
Bowflexn Bowflexn_fiery_wolf fiery_jaws ticks -224125 1413347 3533 5.66 37437 0 9.5 37.8 0.0% 0.0% 0.0% 0.0% 36.13sec 2587103 23.68sec
Bowflexn Bowflexn_fiery_wolf fire_nova 198480 1977459 83493 101.29 37421 74838 15.7 40.0 32.2% 0.0% 0.0% 0.0% 19.49sec 1977459 23.68sec
Bowflexn Bowflexn_fiery_wolf melee 0 1059968 44754 115.95 17536 35080 45.8 45.8 32.1% 0.0% 0.0% 0.0% 6.76sec 1558254 23.68sec
Bowflexn Bowflexn_lightning_wolf crackling_surge 224127 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 35.75sec 0 23.73sec
Bowflexn Bowflexn_lightning_wolf melee 0 1519502 64043 118.65 24523 49062 46.9 46.9 32.0% 0.0% 0.0% 0.0% 6.21sec 2233812 23.73sec
Bowflexn Bowflexn_lightning_wolf thunder_bite 198485 2148720 90563 89.33 46051 92071 15.7 35.3 32.1% 0.0% 0.0% 0.0% 19.29sec 2148720 23.73sec
Alacastria Alacastria arcane_torrent 69179 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 90.30sec 0 400.62sec
Alacastria Alacastria augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Alacastria Alacastria auto_attack_mh 0 5161285 12883 24.63 25488 54449 164.5 164.5 20.4% 0.0% 0.0% 7.5% 2.45sec 7761669 400.62sec
Alacastria Alacastria battle_cry 1719 0 0 0.00 0 0 7.1 0.0 0.0% 0.0% 0.0% 0.0% 60.70sec 0 400.62sec
Alacastria Alacastria deep_wounds ticks -115767 20682678 51707 55.51 43495 93026 317.3 370.1 25.0% 0.0% 0.0% 0.0% 2.19sec 20682678 400.62sec
Alacastria Alacastria demoralizing_shout 1160 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 121.35sec 0 400.62sec
Alacastria Alacastria devastate 20243 13131561 32778 21.00 77478 164623 140.3 140.3 18.5% 0.0% 0.0% 7.5% 2.86sec 19749109 400.62sec
Alacastria Alacastria flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Alacastria Alacastria food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Alacastria Alacastria gaseous_bubble 214972 11077032 27650 4.78 201073 411129 7.0 31.9 69.4% 0.0% 0.0% 0.0% 60.03sec 11077032 400.62sec
Alacastria Alacastria ignore_pain 190456 20243639 50531 35.53 85342 0 26.7 237.2 0.0% 0.0% 0.0% 0.0% 15.49sec 0 400.62sec
Alacastria Alacastria intercept 198304 0 0 0.00 0 0 20.1 0.0 0.0% 0.0% 0.0% 0.0% 20.42sec 0 400.62sec
Alacastria Alacastria neltharions_fury ticks -203524 14839866 37100 4.50 38655 82436 5.0 30.0 100.0% 0.0% 0.0% 0.0% 60.66sec 14839866 400.62sec
Alacastria Alacastria potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.62sec
Alacastria Alacastria revenge 6572 21400592 53419 26.52 95789 202933 42.5 177.0 23.4% 0.0% 0.0% 5.3% 9.23sec 31629502 400.62sec
Alacastria Alacastria shield_block 2565 0 0 0.00 0 0 28.8 0.0 0.0% 0.0% 0.0% 0.0% 14.28sec 0 400.62sec
Alacastria Alacastria shield_block_heavy_repercussions 2565 0 0 0.00 0 0 49.1 0.0 0.0% 0.0% 0.0% 0.0% 8.32sec 0 400.62sec
Alacastria Alacastria shield_slam 23922 13095738 32689 8.45 169702 362033 56.4 56.4 32.4% 0.0% 0.0% 7.5% 7.21sec 19693206 400.62sec
Alacastria Alacastria thunder_clap 6343 9770646 24389 24.38 46925 99454 27.1 162.8 24.9% 0.0% 0.0% 0.0% 10.89sec 14363776 400.62sec

Fluffy_Pillow : 74728 dps, 0 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
74728.1 74728.1 50.9 / 0.068% 10184.7 / 13.6% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 84.43% 5.5 100.0% 100%
Talents
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Scale Factors for other metrics

Scale Factors for Fluffy_Pillow Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Priority Target Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_PillowTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% B% Up%
Fluffy_Pillow 74728
melee_main_hand_Alacastria 9203 12.3% 198.8 2.00sec 18534 9267 Direct 186.3 22846 0 19780 0.0% 13.4% 60.7%  

Stats details: melee_main_hand_Alacastria

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 198.80 186.29 0.00 0.00 2.0000 0.0000 3684638.49 42706471.43 91.37 9267.04 9267.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.13 25.84% 34122.35 0 176313 34103.50 13720 62862 1642247 12745252 87.12
hit (blocked) 54.03 29.01% 23245.39 0 123420 23308.93 9780 42888 1256024 14308430 91.20
hit (crit blocked) 59.12 31.74% 13300.72 1 70526 13330.67 5842 25405 786368 15652789 94.96
parry 25.00 13.42% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_main_hand_Alacastria

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:238283.10
  • base_dd_max:291234.90
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
melee_main_hand_Illistan 42042 56.3% 198.8 2.00sec 84777 42389 Direct 198.8 128528 0 84779 0.0% 34.0% 0.0%  

Stats details: melee_main_hand_Illistan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 198.80 198.80 0.00 0.00 2.0000 0.0000 16854072.78 34718565.73 51.46 42388.77 42388.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 131.13 65.96% 128528.27 45978 180046 128504.09 101967 135874 16854073 34718566 51.46
parry 47.71 24.00% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 19.96 10.04% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_main_hand_Illistan

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Illistan
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:238283.10
  • base_dd_max:291234.90
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
melee_nuke_Alacastria 762 1.0% 14.0 29.10sec 21864 10932 Direct 12.1 25314 0 25314 0.0% 0.0% 74.4%  

Stats details: melee_nuke_Alacastria

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.01 12.10 0.00 0.00 2.0000 0.0000 306343.12 3788803.98 91.91 10932.24 10932.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.10 25.61% 34740.39 3 208354 33405.41 0 207039 107692 970042 85.88
hit (blocked) 4.34 35.88% 28094.49 2 145857 27783.11 0 145595 122013 1359683 90.42
hit (crit blocked) 4.66 38.50% 16453.87 0 83348 16421.34 0 82634 76639 1459079 94.38
 
 

Action details: melee_nuke_Alacastria

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:27.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:281607.30
  • base_dd_max:344186.70
 
melee_nuke_Illistan 5281 7.1% 14.0 29.10sec 150973 75319 Direct 14.0 150974 0 150974 0.0% 0.0% 0.0%  

Stats details: melee_nuke_Illistan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.01 14.01 0.00 0.00 2.0045 0.0000 2115345.93 4385607.12 51.77 75319.42 75319.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.01 100.00% 150974.06 54339 212782 150909.12 117975 178930 2115346 4385607 51.79
 
 

Action details: melee_nuke_Illistan

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:27.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Illistan
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:281607.30
  • base_dd_max:344186.70
 
spell_dot_Alacastria 2720 3.6% 10.2 41.06sec 106998 107001 Periodic 92.1 11827 0 11827 0.0% 0.0% 0.0% 49.5%

Stats details: spell_dot_Alacastria

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.18 0.00 99.17 92.10 1.0000 2.0000 1089159.64 5541855.67 80.35 5223.54 107000.65
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.1 100.00% 11826.81 0 55419 11835.61 5487 18749 1089160 5541856 80.33
 
 

Action details: spell_dot_Alacastria

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:60172.50
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
spell_dot_Illistan 11767 15.7% 10.2 41.06sec 462987 460914 Periodic 99.2 47525 0 47525 0.0% 0.0% 0.0% 49.5%

Stats details: spell_dot_Illistan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.18 0.00 99.17 99.17 1.0045 2.0000 4712843.07 5967080.61 21.02 22597.60 460913.75
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.2 100.00% 47525.13 21799 51903 47529.51 46558 48763 4712843 5967081 21.01
 
 

Action details: spell_dot_Illistan

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Illistan
  • harmful:true
  • if_expr:!ticking
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:60172.50
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
spell_nuke_Alacastria 643 0.9% 11.1 37.11sec 23123 11561 Direct 9.3 27636 0 27636 0.0% 0.0% 0.0%  

Stats details: spell_nuke_Alacastria

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.15 9.33 0.00 0.00 2.0000 0.0000 257809.66 1235104.87 79.13 11561.49 11561.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.33 100.00% 27636.41 4 134111 27731.74 10211 94401 257810 1235105 79.05
 
 

Action details: spell_nuke_Alacastria

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:35.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:119141.55
  • base_dd_max:145617.45
 
spell_nuke_Illistan 2311 3.1% 11.1 37.11sec 83022 41419 Direct 11.1 83022 0 83022 0.0% 0.0% 0.0%  

Stats details: spell_nuke_Illistan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.15 11.15 0.00 0.00 2.0045 0.0000 925673.07 1475737.39 37.27 41418.99 41418.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.15 100.00% 83021.96 43163 125603 82998.19 74290 91711 925673 1475737 37.29
 
 

Action details: spell_nuke_Illistan

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:35.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Illistan
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:119141.55
  • base_dd_max:145617.45
 
Simple Action Stats Execute Interval
Fluffy_Pillow

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 9.50% 9.50% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:9.50%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 9.74% 9.74% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:9.74%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.62% 10.62% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.62%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.05% 11.05% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.05%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.06% 11.06% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.06%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.70% 10.70% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.70%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.56% 10.56% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.56%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.42% 11.42% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.42%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 9.94% 9.94% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:9.94%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.41% 5.41% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.41%

Trigger Attempt Success

  • trigger_pct:100.00%
Anguish 7.4 64.3 54.4sec 4.9sec 6.30% 6.30% 0.0(0.0) 7.3

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.32%
  • anguish_2:0.32%
  • anguish_3:0.32%
  • anguish_4:0.33%
  • anguish_5:0.31%
  • anguish_6:0.31%
  • anguish_7:0.32%
  • anguish_8:0.31%
  • anguish_9:0.32%
  • anguish_10:3.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Anguish 11.7 99.8 33.1sec 3.2sec 10.22% 10.22% 0.0(0.0) 11.7

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.66%
  • anguish_2:0.53%
  • anguish_3:0.53%
  • anguish_4:0.53%
  • anguish_5:0.52%
  • anguish_6:0.56%
  • anguish_7:0.51%
  • anguish_8:0.54%
  • anguish_9:0.52%
  • anguish_10:5.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Demoralizing Shout (_debuff) 3.7 0.0 121.8sec 121.4sec 7.40% 7.10% 0.0(0.0) 3.7

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_demoralizing_shout_debuff
  • max_stacks:1
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
  • default_value:-0.20

Stack Uptimes

  • demoralizing_shout_debuff_1:7.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1160
  • name:Demoralizing Shout
  • tooltip:{$?s199023=false}[Demoralized, dealing $s1% less damage.][Demoralized, dealing $s1% less damage to the shouting Warrior.]
  • description:{$?s199023=false}[Demoralizes all enemies within $A2 yards, reducing the damage they do by $s1% for {$d=8 seconds}.][Demoralizes all enemies within $A2 yards, reducing the damage they do to you by $s1% for {$d=8 seconds}.]{$?s202743=false}[ |cFFFFFFFFGenerates ${$m5/10} Rage.|r][]
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
Ghostly Strike 5.6 21.4 67.5sec 15.1sec 96.48% 96.85% 103.8(103.8) 4.6

Buff details

  • buff initial source:Vait
  • cooldown name:buff_ghostly_strike
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • ghostly_strike_1:96.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196937
  • name:Ghostly Strike
  • tooltip:Taking $s5% increased damage from the Rogue's abilities.
  • description:Strikes an enemy with your cursed weapon, dealing $sw2 Physical damage and causing the target to take $s5% increased damage from your abilities for {$d=15 seconds}. |cFFFFFFFFAwards $s1 combo $lpoint:points;.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark 36.3 0.0 11.0sec 11.0sec 28.57% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:28.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark 37.1 0.3 10.8sec 10.7sec 27.29% 100.00% 0.3(0.3) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:27.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Judgment 33.0 55.6 12.2sec 4.5sec 82.54% 93.79% 55.6(55.6) 32.2

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • judgment_1:82.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's Holy Power consuming abilities.
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${$231661s1+$218178s2} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing $s1 Holy damage{$?s76672=false}|a231663[, and causing them to take $197277s1% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by $231657s1 sec, or ${$231657s1*2} sec on a critical strike][].}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Marked for Death 0.5 0.4 292.5sec 7.9sec 7.94% 7.94% 0.4(0.4) 0.5

Buff details

  • buff initial source:Vait
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marked_for_death_1:7.95%

Trigger Attempt Success

  • trigger_pct:46.60%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Open Wounds 8.8 2.2 39.3sec 32.3sec 54.24% 63.89% 2.2(2.2) 0.7

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:54.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Tempests 1.0 139.6 177.6sec 2.8sec 98.86% 98.86% 487.2(487.2) 0.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_storm_tempests
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • storm_tempests_1:98.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214265
  • name:Storm Tempests
  • tooltip:Zapping nearby allies every $t1 sec.
  • description:{$@spelldesc214260=Enemies hit by your Stormstrike become lightning charged for $s1 sec, zapping a nearby enemy every $214265t1 sec for $214452sw1 Nature damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Vulnerable (vulnerability) 19.0 75.1 20.9sec 4.3sec 87.70% 93.98% 75.1(75.1) 18.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:87.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vulnerable (vulnerability) 20.5 78.3 19.4sec 4.1sec 88.55% 89.90% 78.3(78.3) 19.6

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:88.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Anguish 5.3 44.7 0.0sec 0.0sec 8.49% 8.49% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.45%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.44%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.42%
  • anguish_8:0.41%
  • anguish_9:0.43%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Anguish 9.5 80.0 0.0sec 0.0sec 16.22% 16.22% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.09%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.81%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: bleeding 10.0 0.0 0.0sec 0.0sec 96.84% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add1
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:96.84%
Add1: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 13.63% 76.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.42% 77.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Judgment 18.0 4.9 0.0sec 0.0sec 78.86% 96.43% 4.9(4.9) 11.1

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • judgment_1:78.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's Holy Power consuming abilities.
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${$231661s1+$218178s2} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing $s1 Holy damage{$?s76672=false}|a231663[, and causing them to take $197277s1% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by $231657s1 sec, or ${$231657s1*2} sec on a critical strike][].}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Marked for Death 9.9 2.0 0.0sec 0.0sec 40.83% 40.83% 2.0(2.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marked_for_death_1:40.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Add1: Open Wounds 3.7 0.0 0.0sec 0.0sec 20.90% 47.21% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:20.90%

Trigger Attempt Success

  • trigger_pct:93.37%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Vulnerable (vulnerability) 15.6 20.4 0.0sec 0.0sec 58.08% 76.59% 20.4(20.4) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Vulnerable (vulnerability) 17.2 21.3 0.0sec 0.0sec 61.98% 77.34% 21.3(21.3) 9.5

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:61.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Anguish 5.3 44.7 0.0sec 0.0sec 8.49% 8.49% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.45%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.44%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.42%
  • anguish_8:0.41%
  • anguish_9:0.43%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Anguish 9.5 80.0 0.0sec 0.0sec 16.22% 16.22% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.09%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.81%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: bleeding 10.0 0.0 0.0sec 0.0sec 96.84% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:96.84%
Add2: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 13.63% 76.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.42% 77.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Open Wounds 0.0 0.0 5.2sec 1.8sec 0.07% 0.20% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:0.07%

Trigger Attempt Success

  • trigger_pct:0.76%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Vulnerable (vulnerability) 15.6 20.4 0.0sec 0.0sec 58.08% 76.59% 20.4(20.4) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Vulnerable (vulnerability) 17.2 21.3 0.0sec 0.0sec 61.98% 77.34% 21.3(21.3) 9.5

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:61.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Anguish 5.3 44.7 0.0sec 0.0sec 8.49% 8.49% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.45%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.44%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.42%
  • anguish_8:0.41%
  • anguish_9:0.43%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Anguish 9.5 80.0 0.0sec 0.0sec 16.22% 16.22% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.09%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.81%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: bleeding 10.0 0.0 0.0sec 0.0sec 89.66% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:89.66%
Add3: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 13.63% 76.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.42% 77.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Vulnerable (vulnerability) 15.6 20.4 0.0sec 0.0sec 58.08% 76.59% 20.4(20.4) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Vulnerable (vulnerability) 17.2 21.3 0.0sec 0.0sec 61.98% 77.34% 21.3(21.3) 9.5

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:61.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Anguish 5.3 44.7 0.0sec 0.0sec 8.49% 8.49% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.45%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.44%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.42%
  • anguish_8:0.41%
  • anguish_9:0.43%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Anguish 9.5 80.0 0.0sec 0.0sec 16.22% 16.22% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.09%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.81%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: bleeding 10.0 0.0 0.0sec 0.0sec 89.66% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add4
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:89.66%
Add4: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 13.63% 76.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add4: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.42% 77.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add4: Vulnerable (vulnerability) 15.6 20.4 0.0sec 0.0sec 58.08% 76.59% 20.4(20.4) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Vulnerable (vulnerability) 17.2 21.3 0.0sec 0.0sec 61.98% 77.34% 21.3(21.3) 9.5

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:61.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Anguish 5.3 44.7 0.0sec 0.0sec 8.49% 8.49% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.45%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.44%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.42%
  • anguish_8:0.41%
  • anguish_9:0.43%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Anguish 9.5 80.0 0.0sec 0.0sec 16.22% 16.22% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.09%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.81%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: bleeding 10.0 0.0 0.0sec 0.0sec 89.66% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add5
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:89.66%
Add5: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 13.63% 76.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add5: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.42% 77.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add5: Vulnerable (vulnerability) 15.6 20.4 0.0sec 0.0sec 58.08% 76.59% 20.4(20.4) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Vulnerable (vulnerability) 17.2 21.3 0.0sec 0.0sec 61.98% 77.34% 21.3(21.3) 9.5

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:61.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:95.92%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 3069954.66
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 13120
death count pct 131.16
avg death time 400.32
min death time 307.54
max death time 499.01
dmg taken 1230006136.42

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 9999
Mean 400.62
Minimum 307.54
Maximum 499.01
Spread ( max - min ) 191.47
Range [ ( max - min ) / 2 * 100% ] 23.90%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 9999
Mean 74728.12
Minimum 56457.84
Maximum 84448.21
Spread ( max - min ) 27990.37
Range [ ( max - min ) / 2 * 100% ] 18.73%
Standard Deviation 2595.6183
5th Percentile 70471.15
95th Percentile 78928.17
( 95th Percentile - 5th Percentile ) 8457.02
Mean Distribution
Standard Deviation 25.9575
95.00% Confidence Intervall ( 74677.24 - 74778.99 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4634
0.1 Scale Factor Error with Delta=300 57512
0.05 Scale Factor Error with Delta=300 230051
0.01 Scale Factor Error with Delta=300 5751290
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 74728.12
Minimum 56457.84
Maximum 84448.21
Spread ( max - min ) 27990.37
Range [ ( max - min ) / 2 * 100% ] 18.73%
Damage
Sample Data Fluffy_Pillow Damage
Count 9999
Mean 29945885.77
Minimum 21229668.19
Maximum 39571618.06
Spread ( max - min ) 18341949.87
Range [ ( max - min ) / 2 * 100% ] 30.63%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 3071805.26
Minimum 2954356.02
Maximum 3237513.85
Spread ( max - min ) 283157.82
Range [ ( max - min ) / 2 * 100% ] 4.61%
Standard Deviation 36028.1863
5th Percentile 3014182.86
95th Percentile 3132144.17
( 95th Percentile - 5th Percentile ) 117961.31
Mean Distribution
Standard Deviation 360.2999
95.00% Confidence Intervall ( 3071099.09 - 3072511.44 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 5
0.1% Error 528
0.1 Scale Factor Error with Delta=300 11080732
0.05 Scale Factor Error with Delta=300 44322929
0.01 Scale Factor Error with Delta=300 1108073246
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 2503
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats
Default action list Executed every time the actor is available.
# count action,conditions
1 1.00 auto_attack,damage=264759.004,attack_speed=2,aoe_tanks=1
2 10.20 spell_dot,damage=60172.501,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
3 11.20 spell_nuke,damage=132379.502,cooldown=35,attack_speed=2,aoe_tanks=1
4 14.08 melee_nuke,damage=312897.004,cooldown=27,attack_speed=2,aoe_tanks=1

Sample Sequence

123443243243424324324342342434234234

Sample Sequence Table

time name target resources buffs
0:00.000 auto_attack_tanks Illistan 1231993674.4/1232324440: 100% health vulnerability, vulnerability
0:02.000 spell_dot_Illistan Illistan 1221891145.7/1232324440: 99% health ghostly_strike, demoralizing_shout_debuff, vulnerability, vulnerability
0:03.004 spell_nuke_Illistan Illistan 1217826101.2/1232324440: 99% health ghostly_strike, demoralizing_shout_debuff, vulnerability, vulnerability
0:05.009 melee_nuke_Illistan Illistan 1204915675.1/1232324440: 98% health marked_for_death, ghostly_strike, demoralizing_shout_debuff, vulnerability, hunters_mark, vulnerability, judgment
0:07.013 Waiting 27.000 sec 1191207068.5/1232324440: 97% health marked_for_death, ghostly_strike, storm_tempests, demoralizing_shout_debuff, vulnerability, vulnerability, judgment
0:34.013 melee_nuke_Illistan Illistan 1069609820.8/1232324440: 87% health Health Decade (80 - 90), marked_for_death, ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability
0:36.020 Waiting 4.000 sec 1063102237.8/1232324440: 86% health Health Decade (80 - 90), anguish(10), marked_for_death, ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
0:40.020 spell_nuke_Illistan Illistan 1046439397.0/1232324440: 85% health Health Decade (80 - 90), marked_for_death, ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
0:42.024 Waiting 1.000 sec 1037755788.2/1232324440: 84% health Health Decade (80 - 90), marked_for_death, ghostly_strike, storm_tempests, vulnerability, vulnerability, judgment
0:43.024 spell_dot_Illistan Illistan 1034306935.8/1232324440: 84% health Health Decade (80 - 90), marked_for_death, ghostly_strike, storm_tempests, vulnerability, vulnerability, judgment
0:44.029 Waiting 19.000 sec 1031172150.9/1232324440: 84% health Health Decade (80 - 90), marked_for_death, ghostly_strike, storm_tempests, vulnerability, judgment
1:03.029 melee_nuke_Illistan Illistan 989249580.5/1232324440: 80% health Health Decade (80 - 90), marked_for_death, ghostly_strike, storm_tempests, vulnerability, judgment
1:05.035 Waiting 12.000 sec 981564044.8/1232324440: 80% health Health Decade (70 - 80), marked_for_death, ghostly_strike, storm_tempests, vulnerability, judgment
1:17.035 spell_nuke_Illistan Illistan 944178557.8/1232324440: 77% health Health Decade (70 - 80), ghostly_strike, storm_tempests, open_wounds, hunters_mark, vulnerability, hunters_mark, vulnerability, judgment
1:19.039 Waiting 5.000 sec 939911529.5/1232324440: 76% health Health Decade (70 - 80), ghostly_strike, storm_tempests, open_wounds, hunters_mark, vulnerability, hunters_mark, vulnerability, judgment
1:24.039 spell_dot_Illistan Illistan 928616583.0/1232324440: 75% health Health Decade (70 - 80), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
1:25.044 Waiting 7.000 sec 926363536.1/1232324440: 75% health Health Decade (70 - 80), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
1:32.044 melee_nuke_Illistan Illistan 906893672.1/1232324440: 74% health Health Decade (70 - 80), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
1:34.048 Waiting 20.000 sec 903178673.7/1232324440: 73% health Health Decade (70 - 80), ghostly_strike, storm_tempests, vulnerability, vulnerability, judgment
1:54.048 spell_nuke_Illistan Illistan 849210722.2/1232324440: 69% health Health Decade (60 - 70), ghostly_strike, storm_tempests, open_wounds, hunters_mark, vulnerability, vulnerability, judgment
1:56.052 Waiting 5.000 sec 843447893.8/1232324440: 68% health Health Decade (60 - 70), anguish(9), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
2:01.052 melee_nuke_Illistan Illistan 830560165.2/1232324440: 67% health Health Decade (60 - 70), ghostly_strike, storm_tempests, vulnerability, vulnerability
2:03.056 Waiting 2.000 sec 824335573.3/1232324440: 67% health Health Decade (60 - 70), ghostly_strike, storm_tempests, vulnerability, judgment
2:05.056 spell_dot_Illistan Illistan 818562875.3/1232324440: 66% health Health Decade (60 - 70), ghostly_strike, storm_tempests, demoralizing_shout_debuff, hunters_mark, vulnerability, hunters_mark, vulnerability, judgment
2:06.059 Waiting 24.000 sec 815582196.8/1232324440: 66% health Health Decade (60 - 70), ghostly_strike, storm_tempests, demoralizing_shout_debuff, vulnerability, hunters_mark, vulnerability, judgment
2:30.059 melee_nuke_Illistan Illistan 736366049.2/1232324440: 60% health Health Decade (50 - 60), anguish(10), anguish, ghostly_strike, storm_tempests, vulnerability, judgment
2:32.063 spell_nuke_Illistan Illistan 730188037.1/1232324440: 59% health Health Decade (50 - 60), anguish(10), ghostly_strike, storm_tempests, vulnerability, judgment
2:34.067 Waiting 12.000 sec 724322485.1/1232324440: 59% health Health Decade (50 - 60), ghostly_strike, storm_tempests, vulnerability, judgment
2:46.067 spell_dot_Illistan Illistan 690594109.8/1232324440: 56% health Health Decade (50 - 60), ghostly_strike, storm_tempests, hunters_mark, vulnerability, vulnerability, judgment
2:47.074 Waiting 12.000 sec 686134352.2/1232324440: 56% health Health Decade (50 - 60), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
2:59.074 melee_nuke_Illistan Illistan 654566406.7/1232324440: 53% health Health Decade (50 - 60), anguish(10), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
3:01.079 Waiting 8.000 sec 649432359.1/1232324440: 53% health Health Decade (50 - 60), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability
3:09.079 spell_nuke_Illistan Illistan 624496957.1/1232324440: 51% health Health Decade (50 - 60), ghostly_strike, storm_tempests, vulnerability, judgment
3:11.082 Waiting 16.000 sec 618809122.2/1232324440: 50% health Health Decade (50 - 60), ghostly_strike, storm_tempests, vulnerability, vulnerability
3:27.082 spell_dot_Illistan Illistan 572788759.0/1232324440: 46% health Health Decade (40 - 50), anguish(10), ghostly_strike, storm_tempests, open_wounds, vulnerability, judgment
3:28.086 melee_nuke_Illistan Illistan 570250533.3/1232324440: 46% health Health Decade (40 - 50), anguish, anguish(10), ghostly_strike, storm_tempests, open_wounds, judgment
3:30.093 Waiting 16.000 sec 565025646.9/1232324440: 46% health Health Decade (40 - 50), anguish(10), ghostly_strike, storm_tempests, open_wounds, vulnerability, judgment
3:46.093 spell_nuke_Illistan Illistan 521823072.7/1232324440: 42% health Health Decade (40 - 50), ghostly_strike, storm_tempests, vulnerability, hunters_mark, vulnerability, judgment
3:48.098 Waiting 9.000 sec 515510251.6/1232324440: 42% health Health Decade (40 - 50), ghostly_strike, storm_tempests, vulnerability, hunters_mark, vulnerability, judgment
3:57.098 melee_nuke_Illistan Illistan 495571630.0/1232324440: 40% health Health Decade (40 - 50), anguish, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
3:59.102 Waiting 9.000 sec 491218298.2/1232324440: 40% health Health Decade (30 - 40), storm_tempests, open_wounds, vulnerability, vulnerability, judgment
4:08.102 spell_dot_Illistan Illistan 461820857.9/1232324440: 37% health Health Decade (30 - 40), ghostly_strike, storm_tempests, demoralizing_shout_debuff, open_wounds, vulnerability, vulnerability, judgment
4:09.107 Waiting 14.000 sec 458467190.4/1232324440: 37% health Health Decade (30 - 40), ghostly_strike, storm_tempests, demoralizing_shout_debuff, open_wounds, vulnerability, vulnerability, judgment
4:23.107 spell_nuke_Illistan Illistan 408371541.0/1232324440: 33% health Health Decade (30 - 40), ghostly_strike, storm_tempests, open_wounds, vulnerability
4:25.110 Waiting 1.000 sec 402500450.3/1232324440: 33% health Health Decade (30 - 40), ghostly_strike, storm_tempests, open_wounds, vulnerability, judgment
4:26.110 melee_nuke_Illistan Illistan 399339128.1/1232324440: 32% health Health Decade (30 - 40), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
4:28.115 Waiting 21.000 sec 394255187.9/1232324440: 32% health Health Decade (30 - 40), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
4:49.115 spell_dot_Illistan Illistan 329260203.6/1232324440: 27% health Health Decade (20 - 30), ghostly_strike, storm_tempests, vulnerability, hunters_mark, vulnerability, judgment
4:50.118 Waiting 5.000 sec 326731650.8/1232324440: 27% health Health Decade (20 - 30), ghostly_strike, storm_tempests, vulnerability, hunters_mark, vulnerability, judgment
4:55.118 melee_nuke_Illistan Illistan 317532050.4/1232324440: 26% health Health Decade (20 - 30), ghostly_strike, storm_tempests, vulnerability, vulnerability, judgment
4:57.123 Waiting 3.000 sec 312535303.8/1232324440: 25% health Health Decade (20 - 30), ghostly_strike, storm_tempests, vulnerability, vulnerability, judgment
5:00.123 spell_nuke_Illistan Illistan 306103348.1/1232324440: 25% health Health Decade (20 - 30), ghostly_strike, storm_tempests, vulnerability, judgment
5:02.127 Waiting 22.000 sec 302167279.0/1232324440: 25% health Health Decade (20 - 30), ghostly_strike, storm_tempests, vulnerability, judgment
5:24.127 melee_nuke_Illistan Illistan 232098083.9/1232324440: 19% health Health Decade (10 - 20), ghostly_strike, storm_tempests, open_wounds, vulnerability
5:26.132 Waiting 4.000 sec 225550916.7/1232324440: 18% health Health Decade (10 - 20), ghostly_strike, storm_tempests, open_wounds, vulnerability, hunters_mark, vulnerability
5:30.132 spell_dot_Illistan Illistan 214827139.4/1232324440: 17% health Health Decade (10 - 20), ghostly_strike, storm_tempests, open_wounds, hunters_mark, vulnerability, hunters_mark, vulnerability, judgment
5:31.135 Waiting 6.000 sec 212032949.4/1232324440: 17% health Health Decade (10 - 20), ghostly_strike, storm_tempests, open_wounds, hunters_mark, vulnerability, hunters_mark, vulnerability, judgment
5:37.135 spell_nuke_Illistan Illistan 191912562.3/1232324440: 16% health Health Decade (10 - 20), ghostly_strike, storm_tempests, open_wounds, vulnerability, hunters_mark, vulnerability
5:39.140 Waiting 14.000 sec 186481980.5/1232324440: 15% health Health Decade (10 - 20), ghostly_strike, storm_tempests, open_wounds, hunters_mark, vulnerability, judgment
5:53.140 melee_nuke_Illistan Illistan 140538622.2/1232324440: 11% health Health Decade (10 - 20), ghostly_strike, storm_tempests, open_wounds, hunters_mark, vulnerability, hunters_mark, vulnerability, judgment
5:55.146 Waiting 16.000 sec 134357733.6/1232324440: 11% health Health Decade (10 - 20), ghostly_strike, storm_tempests, open_wounds, hunters_mark, vulnerability, hunters_mark, vulnerability, judgment
6:11.146 spell_dot_Illistan Illistan 77256892.6/1232324440: 6% health Health Decade (0 - 10), ghostly_strike, storm_tempests, demoralizing_shout_debuff, open_wounds, hunters_mark, vulnerability, vulnerability, judgment
6:12.151 Waiting 2.000 sec 74880185.6/1232324440: 6% health Health Decade (0 - 10), ghostly_strike, storm_tempests, demoralizing_shout_debuff, open_wounds, hunters_mark, vulnerability, vulnerability, judgment
6:14.151 spell_nuke_Illistan Illistan 67351224.9/1232324440: 5% health Health Decade (0 - 10), ghostly_strike, storm_tempests, demoralizing_shout_debuff, open_wounds, vulnerability, hunters_mark, vulnerability, judgment
6:16.155 Waiting 6.000 sec 56125097.2/1232324440: 5% health Health Decade (0 - 10), ghostly_strike, storm_tempests, open_wounds, vulnerability, hunters_mark, vulnerability, judgment
6:22.155 melee_nuke_Illistan Illistan 36200050.9/1232324440: 3% health Health Decade (0 - 10), ghostly_strike, storm_tempests, hunters_mark, vulnerability, judgment
6:24.160 Waiting 9.000 sec 28821827.1/1232324440: 2% health Health Decade (0 - 10), ghostly_strike, storm_tempests, hunters_mark, vulnerability

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1474364041 0
Melee Crit 0.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste INF% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 0 3474 3474
Tank-Miss 0.00% 3.00% 0
Tank-Dodge 0.00% 3.00% 0
Tank-Parry 0.00% 3.00% 0
Tank-Block 0.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.
actions=auto_attack,damage=264759.004,attack_speed=2,aoe_tanks=1
actions+=/spell_dot,damage=60172.501,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
actions+=/spell_nuke,damage=132379.502,cooldown=35,attack_speed=2,aoe_tanks=1
actions+=/melee_nuke,damage=312897.004,cooldown=27,attack_speed=2,aoe_tanks=1


# Gear Summary
# gear_ilvl=0.00

Fluffy_Pillow_Add1 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add1: Anguish 5.3 44.7 0.0sec 0.0sec 8.49% 8.49% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.45%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.44%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.42%
  • anguish_8:0.41%
  • anguish_9:0.43%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Anguish 9.5 80.0 0.0sec 0.0sec 16.22% 16.22% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.09%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.81%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: bleeding 10.0 0.0 0.0sec 0.0sec 96.84% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add1
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:96.84%
Add1: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 13.63% 76.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.42% 77.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Judgment 18.0 4.9 0.0sec 0.0sec 78.86% 96.43% 4.9(4.9) 11.1

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • judgment_1:78.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's Holy Power consuming abilities.
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${$231661s1+$218178s2} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing $s1 Holy damage{$?s76672=false}|a231663[, and causing them to take $197277s1% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by $231657s1 sec, or ${$231657s1*2} sec on a critical strike][].}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Marked for Death 9.9 2.0 0.0sec 0.0sec 40.83% 40.83% 2.0(2.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marked_for_death_1:40.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Add1: Open Wounds 3.7 0.0 0.0sec 0.0sec 20.90% 47.21% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:20.90%

Trigger Attempt Success

  • trigger_pct:93.37%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Vulnerable (vulnerability) 15.6 20.4 0.0sec 0.0sec 58.08% 76.59% 20.4(20.4) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Vulnerable (vulnerability) 17.2 21.3 0.0sec 0.0sec 61.98% 77.34% 21.3(21.3) 9.5

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:61.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add1
Resource RPS-Gain RPS-Loss
Health 0.00 956470.15
Combat End Resource Mean Min Max
Health 1211767130.45 962828676.63 1457675093.26

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add1 Fight Length
Count 9999
Mean 200.00
Minimum 197.54
Maximum 200.00
Spread ( max - min ) 2.46
Range [ ( max - min ) / 2 * 100% ] 0.61%
DPS
Sample Data Add1 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add1 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add1 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add1 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add1 Damage Taken Per Second
Count 9999
Mean 956470.15
Minimum 874478.87
Maximum 1030871.79
Spread ( max - min ) 156392.92
Range [ ( max - min ) / 2 * 100% ] 8.18%
HPS
Sample Data Add1 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add1 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add1 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add1 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add1Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add1 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1474317967 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add1"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Add2 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add2: Anguish 5.3 44.7 0.0sec 0.0sec 8.49% 8.49% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.45%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.44%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.42%
  • anguish_8:0.41%
  • anguish_9:0.43%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Anguish 9.5 80.0 0.0sec 0.0sec 16.22% 16.22% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.09%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.81%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: bleeding 10.0 0.0 0.0sec 0.0sec 96.84% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:96.84%
Add2: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 13.63% 76.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.42% 77.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Open Wounds 0.0 0.0 5.2sec 1.8sec 0.07% 0.20% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:0.07%

Trigger Attempt Success

  • trigger_pct:0.76%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Vulnerable (vulnerability) 15.6 20.4 0.0sec 0.0sec 58.08% 76.59% 20.4(20.4) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Vulnerable (vulnerability) 17.2 21.3 0.0sec 0.0sec 61.98% 77.34% 21.3(21.3) 9.5

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:61.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add2
Resource RPS-Gain RPS-Loss
Health 0.00 877298.44
Combat End Resource Mean Min Max
Health 1212829063.95 962371623.19 1458505087.46

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add2 Fight Length
Count 9999
Mean 200.00
Minimum 197.54
Maximum 200.00
Spread ( max - min ) 2.46
Range [ ( max - min ) / 2 * 100% ] 0.61%
DPS
Sample Data Add2 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add2 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add2 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add2 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add2 Damage Taken Per Second
Count 9999
Mean 877298.44
Minimum 804797.14
Maximum 957210.70
Spread ( max - min ) 152413.57
Range [ ( max - min ) / 2 * 100% ] 8.69%
HPS
Sample Data Add2 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add2 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add2 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add2 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add2 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add2Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add2 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1474317967 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add2"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Add3 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add3: Anguish 5.3 44.7 0.0sec 0.0sec 8.49% 8.49% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.45%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.44%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.42%
  • anguish_8:0.41%
  • anguish_9:0.43%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Anguish 9.5 80.0 0.0sec 0.0sec 16.22% 16.22% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.09%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.81%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: bleeding 10.0 0.0 0.0sec 0.0sec 89.66% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:89.66%
Add3: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 13.63% 76.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.42% 77.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Vulnerable (vulnerability) 15.6 20.4 0.0sec 0.0sec 58.08% 76.59% 20.4(20.4) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Vulnerable (vulnerability) 17.2 21.3 0.0sec 0.0sec 61.98% 77.34% 21.3(21.3) 9.5

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:61.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add3
Resource RPS-Gain RPS-Loss
Health 0.00 765527.40
Combat End Resource Mean Min Max
Health 1215107424.22 966595109.16 1460470833.62

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add3 Fight Length
Count 9999
Mean 200.00
Minimum 197.54
Maximum 200.00
Spread ( max - min ) 2.46
Range [ ( max - min ) / 2 * 100% ] 0.61%
DPS
Sample Data Add3 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add3 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add3 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add3 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add3 Damage Taken Per Second
Count 9999
Mean 765527.40
Minimum 708358.38
Maximum 837490.14
Spread ( max - min ) 129131.75
Range [ ( max - min ) / 2 * 100% ] 8.43%
HPS
Sample Data Add3 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add3 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add3 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add3 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1474317967 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add3"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Add4 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add4: Anguish 5.3 44.7 0.0sec 0.0sec 8.49% 8.49% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.45%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.44%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.42%
  • anguish_8:0.41%
  • anguish_9:0.43%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Anguish 9.5 80.0 0.0sec 0.0sec 16.22% 16.22% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.09%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.81%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: bleeding 10.0 0.0 0.0sec 0.0sec 89.66% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add4
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:89.66%
Add4: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 13.63% 76.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add4: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.42% 77.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add4: Vulnerable (vulnerability) 15.6 20.4 0.0sec 0.0sec 58.08% 76.59% 20.4(20.4) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Vulnerable (vulnerability) 17.2 21.3 0.0sec 0.0sec 61.98% 77.34% 21.3(21.3) 9.5

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:61.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add4
Resource RPS-Gain RPS-Loss
Health 0.00 753837.05
Combat End Resource Mean Min Max
Health 1215353787.29 966381126.40 1460203742.18

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add4 Fight Length
Count 9999
Mean 200.00
Minimum 197.54
Maximum 200.00
Spread ( max - min ) 2.46
Range [ ( max - min ) / 2 * 100% ] 0.61%
DPS
Sample Data Add4 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add4 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add4 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add4 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add4 Damage Taken Per Second
Count 9999
Mean 753837.05
Minimum 679635.04
Maximum 825210.49
Spread ( max - min ) 145575.46
Range [ ( max - min ) / 2 * 100% ] 9.66%
HPS
Sample Data Add4 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add4 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add4 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add4 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add4 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add4Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add4 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1474317967 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add4"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Add5 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add5: Anguish 5.3 44.7 0.0sec 0.0sec 8.49% 8.49% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.45%
  • anguish_2:0.44%
  • anguish_3:0.43%
  • anguish_4:0.44%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.42%
  • anguish_8:0.41%
  • anguish_9:0.43%
  • anguish_10:4.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Anguish 9.5 80.0 0.0sec 0.0sec 16.22% 16.22% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.09%
  • anguish_2:0.82%
  • anguish_3:0.82%
  • anguish_4:0.81%
  • anguish_5:0.82%
  • anguish_6:0.90%
  • anguish_7:0.81%
  • anguish_8:0.86%
  • anguish_9:0.82%
  • anguish_10:8.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: bleeding 10.0 0.0 0.0sec 0.0sec 89.66% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add5
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:89.66%
Add5: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 13.63% 76.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add5: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.42% 77.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add5: Vulnerable (vulnerability) 15.6 20.4 0.0sec 0.0sec 58.08% 76.59% 20.4(20.4) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Vulnerable (vulnerability) 17.2 21.3 0.0sec 0.0sec 61.98% 77.34% 21.3(21.3) 9.5

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:61.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add5
Resource RPS-Gain RPS-Loss
Health 0.00 768607.31
Combat End Resource Mean Min Max
Health 1215234249.39 967025726.52 1460573401.05

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add5 Fight Length
Count 9999
Mean 200.00
Minimum 197.54
Maximum 200.00
Spread ( max - min ) 2.46
Range [ ( max - min ) / 2 * 100% ] 0.61%
DPS
Sample Data Add5 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add5 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add5 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add5 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add5 Damage Taken Per Second
Count 9999
Mean 768607.31
Minimum 699315.40
Maximum 847854.76
Spread ( max - min ) 148539.36
Range [ ( max - min ) / 2 * 100% ] 9.66%
HPS
Sample Data Add5 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add5 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add5 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add5 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add5 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add5Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add5 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1474317967 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add5"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 400.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.